KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069742
Entry
103069742         CDS       T03090                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve01100  Metabolic pathways
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04144  Endocytosis
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04912  GnRH signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve05200  Pathways in cancer
lve05212  Pancreatic cancer
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103069742 (PLD2)
   00565 Ether lipid metabolism
    103069742 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103069742 (PLD2)
   04072 Phospholipase D signaling pathway
    103069742 (PLD2)
   04071 Sphingolipid signaling pathway
    103069742 (PLD2)
   04024 cAMP signaling pathway
    103069742 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103069742 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103069742 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103069742 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    103069742 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103069742 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103069742 (PLD2)
   05231 Choline metabolism in cancer
    103069742 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103069742 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103069742 (PLD2)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     103069742 (PLD2)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103069742 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    103069742 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 103069742
NCBI-ProteinID: XP_007457771
UniProt: A0A340X8R5
LinkDB
Position
Un
AA seq 933 aa
MAATSERLFPSGGDLDSSQLQMEPDEVDTLKEGEDPADRMHPFLAIYDLQPLKIHPLVFA
PGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPAQEANNREMPSLPRAGPEGSSRHAASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGTITFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAHGPGRDFVQLHRHESYAPPRPGTLARWFVNGAGYFAAAADAILQAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDMMLKKKAEEGVRVSVLLFKEVELALAINSGYSKKAL
MLLHPNIKVMRHPDHVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLRDSSE
SAAPQPPTSCSDPPATPDLSHNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGSPARDLARHFIQRWNFTKTTKAKYKIPMYPYLLPKSTSTANQLPFMLPGVQ
CATVQVLRSVDRWSAGTSENSILNAYLHSIRESQHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCFRVYMLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAVMGTAWRDYISICGLRTHGELGSHLVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEASLMNGVEYEAGRFALSLRKHCFSVILGADARPDLDLRDPVCD
DFFQSWQDTAESNANIYEQIFRCLPSNATRSLRALREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGVIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atggcggcgacctccgagagactcttcccctctgggggtgacctggactccagccagtta
cagatggagcccgatgaggtggacactctgaaggagggagaggacccagctgaccggatg
cacccctttctggccatctacgacctccagcctctgaaaattcaccccttggtgtttgcc
cctggggttcccgtcatagcccaggtggtgggcactgaaagatacaccagtggatccaag
gtgggcacctgcactctgtattctgtccgcttgactcacggtgactttacctggacaacc
aagaagaagttccgtcatttccaggaattgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgctttgctgttgcctattctccagcccaagaggcaaac
aacagagagatgccctctctaccccgagcaggtcctgagggctcctccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgcctcctgaccatgtctttctaccgc
aactaccacgccatgacagagtttctggaagtcagtcagctgtcctttatcccagacctt
ggatccaaaggactggagggggtgatccggaagcgctcaggtggccaccgtgttcctggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagcggtggctggtggtg
aaggactccttcctgctgtacatgtgcctagagaccggcaccatcacatttgttcagctc
ttcgaccctggcttcgaggtacaggtggggaaaaggagcacagaggcacggtacggggtc
cggatcgacacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaggagatcaccgagctggcccacggcccgggcagagattttgtacagctg
caccggcacgagagctacgctccaccccggcctgggaccctggcccggtggtttgtgaat
ggggcaggttactttgctgctgcagctgatgccatcctgcaagctcaagaagagattttc
atcacagactggtggttgagtcctgagatttacctgaagcgtccggcccattcagatgac
tggagactggacatgatgctcaagaagaaggcggaggagggtgtccgggtgtccgtactg
ctgtttaaggaagtggagttggccttggccatcaacagtggctatagcaagaaggctctg
atgctactacatcccaacataaaggtgatgcgccacccagaccacgtgactctgtgggcc
catcatgagaagctcctggtggtggaccaagtagtggccttcttgggggggctggacctc
gcctatggccgctgggatgacctgcactacagattgactgaccttcgggactcctctgag
tcagctgccccccagcctcccacctcatgctcagaccctccagctacaccagacctctct
cacaaccagctcttctggctgggcaaggactacagcaatcttatcactaaggactgggtc
cagctggatcggccttttgaggatttcattgacagggagaccacaccccggatgccatgg
cgggacgtcggggtggtggtccatggctcacccgccagggaccttgcccggcacttcatc
cagcgctggaatttcaccaagaccaccaaggccaagtacaagatacccatgtacccctac
ctgctgcccaagtccaccagcaccgcaaaccagctccctttcatgctcccgggagtgcag
tgcgccaccgtgcaggtcttgcggtcagtggaccgctggtcagcggggacctcggagaac
tccatcctcaacgcctacctgcacagcatcagggagagccagcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggtgctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgcttccgagtctacatgctt
ttgcccctgctccccgggttcgagggcgacatctccacaggtggtggtaattccatccag
gccattctgcacttcacttacaggacgctgtgtcgtggggaatattcaattctacatcgc
ctcaaagcagtcatggggacagcgtggcgggactatatttccatctgtgggcttcgcaca
cacggagagctgggtagccacctggtctcagagctcatctacatccacagcaagatgctc
attgcagatgaccggacggtcatcattggctccgcaaacatcaatgaccggagtttactg
gggaagcgggacagtgagctggcggtgctgatcgaggacacggagatggaggcctccctc
atgaatggtgtggaatatgaggcgggcaggtttgccttgagtttgcggaaacactgcttc
agcgtgattcttggggcagatgcccggccggacctcgatctccgagaccctgtctgtgat
gacttcttccagtcatggcaagacacagctgagagcaatgccaatatctatgagcagatc
ttccgctgcctgccgtccaacgccactcgctccctgcgggcactccgggagtatgtggcc
gtggagccgctggccacggtcagccctcccttggcccggtctgaactcacccaggtccag
ggccacctggtccacttccccctcaagttcctggaggatgagtctttgctgccccccctg
gggagcaaggagggcgtgatacccctagaagtgtggacatag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084538
Entry
103084538         CDS       T03090                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00564  Glycerophospholipid metabolism
lve00565  Ether lipid metabolism
lve01100  Metabolic pathways
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04144  Endocytosis
lve04666  Fc gamma R-mediated phagocytosis
lve04724  Glutamatergic synapse
lve04912  GnRH signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve05200  Pathways in cancer
lve05212  Pancreatic cancer
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103084538 (PLD1)
   00565 Ether lipid metabolism
    103084538 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103084538 (PLD1)
   04072 Phospholipase D signaling pathway
    103084538 (PLD1)
   04071 Sphingolipid signaling pathway
    103084538 (PLD1)
   04024 cAMP signaling pathway
    103084538 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103084538 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103084538 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103084538 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    103084538 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103084538 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103084538 (PLD1)
   05231 Choline metabolism in cancer
    103084538 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103084538 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103084538 (PLD1)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     103084538 (PLD1)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103084538 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    103084538 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH zf-C2HE
Other DBs
NCBI-GeneID: 103084538
NCBI-ProteinID: XP_007464775
UniProt: A0A340XZY6
LinkDB
Position
Un
AA seq 1074 aa
MSLKDEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPRIQEAYIPFSA
IYKTQGFKEPNTQTYLSGCPIKVQVLEVERLTSTKKVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSESMIQEEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRVKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIHKHGPNFLKDHRFGSYAALQENTLAKWYVNAKG
YFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYSKRTLMHLHPNIKVMRHPDHVSSSVYLWAHHEKLIIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVIGRPSLSSLTAETTESMESLSLKDKNESNKNLPVLKT
VDDADSKLKGIGKPRKFSKFSLYRQLHRHHLRNTDSISSIDSASSDCNHCRSRQNLIHGL
KPHLKLFRSSSESEQGLPRPNVDTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRHSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKPKYRSLSYPFLL
PKSQTTAHELKHQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVYVIENSKHYIYIE
NQFFISCSDDKVVFNKVGDAIAQRILKAHRESQRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAEIGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDAETVPSVMDGKEYQAGHFALGLRLQCF
RVVLGYLSDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRYFI
SKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEENLLPSVGTKEAMVPTEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaagatgagccaagagtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatttgatagaaaatctggacacgcgggagctccactttgagggagaggaggtg
gactacgatgtgtctcccagcgatcccaggatacaggaagcgtatatccctttctctgct
atttataagactcaaggatttaaggagcctaatacacagacgtatctctccggctgtcca
ataaaagttcaagttctggaagtggagcgcttaacatctacaaaaaaggtaccaagcatc
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaagttc
aagcacttccaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccaccagaagacacacatttagaagacagaatgtcaaagaagagcctcgagagatg
ccaagtttgccccgttcatctgaaagcatgatccaagaagaacagttctttggtagaagg
aaacaactagaggattacttgacaaaattactaaaaatgcccatgtatagaaactatcat
gcaacaacagaattccttgatataagccagctgtccttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatccggtggacacagaataccaggcttgaactgc
tgtggtcagggaagggcctgctaccggtggtccaaaaggtggttgatagtaaaagattcc
tttttactatatatgaaaccagacagtggtgctattgccttcgtcctgctggtagataaa
gaattcagagttaaggtgggaaagaaggagacggagacaaaatatggactccgaattgat
aatctttcaaggacactgatcttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccataaacatggccccaactttctcaaagatcatcgattt
gggtcttatgctgctctccaagagaacactttagctaaatggtacgttaatgccaaagga
tattttgaagatgtggcgaatgcaatggaagaggcaaaagaagagatttttatcacagat
tggtggttgagtccagaaatcttcctgaaacgtccggtggttgaaggaaatcgttggagg
ttggactgcattcttaagcgaaaagcacaacagggggtgcgtatcttcattatgctctac
aaagaggtggaacttgctcttggaatcaatagtgaatacagcaagaggactttgatgcat
ctacaccccaacataaaggtgatgaggcacccagatcatgtgtcatccagtgtatatctg
tgggctcatcacgagaaactcatcatcatcgaccagtcggttgcctttgtgggtgggatt
gacctggcctatggaaggtgggatgacaatgaacacagactcacggacgtgggcagcgtg
aagcgcgtcatcgggagaccttctctgagttccctcacagctgaaacaacagagtctatg
gaatccttaagcctcaaagataaaaacgaatctaacaaaaatctgcctgtcctgaagact
gttgatgatgcagactcaaaactgaaaggaataggaaagcccagaaagttctccaaattc
agcctctacaggcagctgcacagacaccacctacgcaacacagacagcatcagcagcatt
gacagcgcctccagtgattgtaatcactgtaggagtcgtcagaatttaatccatggttta
aagccccacttgaaactctttcgctcttccagtgagtctgagcaggggctccctagacct
aacgttgacacgggctccatccgaagtttacagacaggtgtgggagagctacatggggaa
accagattctggcatggaaaggactactgcaattttgtcttcaaagattgggttcaactt
gataaaccttttgctgatttcattgacaggcactccaccccccggatgccatggcacgac
atcgcctctgcagtccacgggaaggcggctcgcgacgtagcccgtcacttcatccagcgc
tggaacttcacaaagattatgaaaccaaaatatcggtccctttcttatccttttctgctt
ccaaaatctcaaacaacagcccatgagttgaaacaccaagtgcctgggtctgtccatgct
aatgtacagttgctccgttctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgctgcttacgtctatgtgatagagaacagcaagcactatatctatatagaa
aaccagtttttcataagctgctctgatgacaaagttgtgttcaacaaggttggcgatgcc
attgctcagaggatactgaaagctcacagggaaagccagagataccgggtttatgttgtg
ataccacttctgccaggttttgaaggagacatttcaaccggtggaggaaatgctctacag
gcaataatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacaa
ttaaaagcagagatcggcaatcagtggataaattacatatccttctgtggtcttagaaca
cacgcagagcttgaaggaaacctcgtcactgagcttatctatgtccacagcaagttgcta
attgctgatgacaacactgttattattggctctgccaacataaacgaccgaagcatgctg
ggaaaacgggacagtgaaatggctgtcattgtgcaggacgcggagacggtcccttcagta
atggatggaaaagagtaccaagctggccacttcgccctaggacttcggctgcagtgcttt
cgggttgtcctcggctatctttctgaccctagtgaagacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacggcagctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcagctgagatactttata
agcaagcccattttagcaaaggaagatcccattagagctgaggaagaactgaaaaagatc
cgtgggttcttggtacaattccccttttacttcctgtctgaagaaaacctactgccttct
gttggaaccaaagaagccatggtgcccaccgaggtttggacttaa

DBGET integrated database retrieval system