KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069922Help
Entry
103069922         CDS       T03090                                 

Gene name
TFAP4
Definition
(RefSeq) transcription factor AP-4
  KO
K09108  transcription factor AP-4
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103069922 (TFAP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103069922 (TFAP4)
Transcription factors [BR:lve03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    103069922 (TFAP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH COE1_HLH
Motif
Other DBs
NCBI-GeneID: 103069922
NCBI-ProteinID: XP_007453540
UniProt: A0A340X312
LinkDB All DBs
Position
Un
AA seq 338 aa AA seqDB search
MEYFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRR
MQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQEL
SGSSPKRRRAEDKDEGIGSPDIWEDEKAEDLRREMIELRQQLDKERSVRMMLEEQVRSLE
AHMYPEKLKVIAQQVQLQQQQEQVRLLHQEKLEREQQHLRTQLLPTPAPTHHPTVIVPAP
APPPSHHINVVTMGPSSVINSVSTSRQNLDTIVQAIQHIEGTQERQEQEEEQRRAVIVKP
VRNCPEAHASDTASDSEASDSDAMDQSREEPVGNGGLP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggagtatttcatggtgcccactcagaaggtgccctctttgcaacatttcaggaaaaca
gagaaagaagtgataggagggctctgtagccttgccaacattccattaacccctgagact
cagcgggaccaggagcggcggattcggcgggaaattgctaacagcaacgagcggaggcgc
atgcagagcatcaacgcggggttccagtccctcaagaccctcatcccccacacagatgga
gagaagctcagcaaggcagccattctccagcaaacggccgaatacatcttctccctggag
caggagaagaccaggcttctgcagcagaacacacagctcaagcgctttatccaggagctg
agcggctcatcccccaagcggcggcgggcagaggacaaggacgagggcatcggctcgcca
gacatctgggaggacgagaaggcggaggacctgcggcgggagatgattgagctgcggcag
cagctggacaaggagcgctcggtgcgcatgatgctggaggagcaggtgcgctcactggag
gcccacatgtacccggaaaagctcaaggtgatcgcacagcaggtgcagctgcaacagcag
caggagcaggtgcggctgctgcaccaggagaagctggagcgggaacagcagcacctgcgg
acccagcttctgcccactccagcccctacccaccatcccacggtgatcgtgccggcgcca
gcgccccctccctcccaccacatcaatgtcgtcaccatgggcccctcctcggtcatcaac
tctgtttcaacatcccggcaaaatctggacaccattgtgcaggcgatccagcacatcgag
ggcacccaggaaaggcaggagcaggaggaggagcagcgtcgagccgtcatcgtgaagccg
gtccgcaactgccccgaggcccacgcctccgataccgcctccgattcggaggcctcggac
agcgacgccatggaccagagccgggaggagccagtggggaacgggggtcttccctga

DBGET integrated database retrieval system