KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070213
Entry
103070213         CDS       T03090                                 

Gene name
GNRH1
Definition
(RefSeq) gonadotropin releasing hormone 1
  KO
K05252  gonadotropin-releasing hormone
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
lve04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103070213 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103070213 (GNRH1)
   04912 GnRH signaling pathway
    103070213 (GNRH1)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 103070213
NCBI-ProteinID: XP_007458885
UniProt: A0A340XIM4
LinkDB
Position
Un
AA seq 95 aa
MFLRMEPSPKLLAGLTLLILCVVGCSSQHWSYGLRPGGKRNAENVLDSFQEIAKEVDQPA
EPPRFECTIHQRRSPLRDLKGALESLIEEETGQKM
NT seq 288 nt   +upstreamnt  +downstreamnt
atgttccttagaatggagccgagtccaaaacttctagctggacttactctgctgattctc
tgtgtggtgggctgctccagccagcactggtcctatgggttgcgccccggaggaaagaga
aatgctgaaaatgtgcttgattctttccaagagatagccaaagaagttgatcaaccagca
gaacctccgcgctttgagtgcaccatacaccagcgccgttctccactcagggacctgaaa
ggagctctggaaagtctgatcgaagaggaaactggtcagaagatgtaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085292
Entry
103085292         CDS       T03090                                 

Gene name
GNRH2
Definition
(RefSeq) gonadotropin releasing hormone 2
  KO
K05252  gonadotropin-releasing hormone
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
lve04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103085292 (GNRH2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    103085292 (GNRH2)
   04912 GnRH signaling pathway
    103085292 (GNRH2)
SSDB
Other DBs
NCBI-GeneID: 103085292
NCBI-ProteinID: XP_007465493
UniProt: A0A340XWA6
LinkDB
Position
Un
AA seq 123 aa
MASFGLGLLVLLLTTHPEPSKAQHCSHSWHPEGKQASSSLHDPQHTPGPPDQIVPNLPSD
VLAPPEDSVPWESRTMARWLLHRKQHLVQTLLYGPNNQVVIDTCTGNDSVIAELPKANSG
RQV
NT seq 372 nt   +upstreamnt  +downstreamnt
atggccagctttgggctaggcctcctggtgctgctgctgaccacccaccctgagccctcg
aaggctcagcactgctcccacagctggcaccctgaaggaaagcaagcctccagctcactc
catgacccccaacatactcctgggcccccagaccaaattgtccccaacctcccaagcgat
gttctggctccccctgaggacagtgtgccctgggagagtaggaccatggcccggtggctc
ctccacaggaagcagcacctggtgcagacactgctgtacggccccaataaccaggtggtc
attgatacgtgcactgggaatgactcagtgattgcagagctccccaaggccaatagcgga
agacaggtgtag

DBGET integrated database retrieval system