KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070387
Entry
103070387         CDS       T03090                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04114  Oocyte meiosis
lve04210  Apoptosis
lve04218  Cellular senescence
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04621  NOD-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05014  Amyotrophic lateral sclerosis
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103070387 (ITPR3)
   04020 Calcium signaling pathway
    103070387 (ITPR3)
   04070 Phosphatidylinositol signaling system
    103070387 (ITPR3)
   04022 cGMP-PKG signaling pathway
    103070387 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103070387 (ITPR3)
   04210 Apoptosis
    103070387 (ITPR3)
   04218 Cellular senescence
    103070387 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103070387 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103070387 (ITPR3)
   04621 NOD-like receptor signaling pathway
    103070387 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    103070387 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    103070387 (ITPR3)
   04922 Glucagon signaling pathway
    103070387 (ITPR3)
   04929 GnRH secretion
    103070387 (ITPR3)
   04912 GnRH signaling pathway
    103070387 (ITPR3)
   04915 Estrogen signaling pathway
    103070387 (ITPR3)
   04921 Oxytocin signaling pathway
    103070387 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    103070387 (ITPR3)
   04918 Thyroid hormone synthesis
    103070387 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    103070387 (ITPR3)
   04924 Renin secretion
    103070387 (ITPR3)
   04925 Aldosterone synthesis and secretion
    103070387 (ITPR3)
   04927 Cortisol synthesis and secretion
    103070387 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103070387 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    103070387 (ITPR3)
   04971 Gastric acid secretion
    103070387 (ITPR3)
   04972 Pancreatic secretion
    103070387 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103070387 (ITPR3)
   04725 Cholinergic synapse
    103070387 (ITPR3)
   04728 Dopaminergic synapse
    103070387 (ITPR3)
   04726 Serotonergic synapse
    103070387 (ITPR3)
   04720 Long-term potentiation
    103070387 (ITPR3)
   04730 Long-term depression
    103070387 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    103070387 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    103070387 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    103070387 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103070387 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103070387 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103070387 (ITPR3)
   05012 Parkinson disease
    103070387 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    103070387 (ITPR3)
   05017 Spinocerebellar ataxia
    103070387 (ITPR3)
   05020 Prion disease
    103070387 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    103070387 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103070387 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103070387 (ITPR3)
   05163 Human cytomegalovirus infection
    103070387 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103070387 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103070387 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103070387 (ITPR3)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103070387 (ITPR3)
Ion channels [BR:lve04040]
 Ligand-gated channels
  IP3 receptor
   103070387 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103070387
NCBI-ProteinID: XP_007460905
UniProt: A0A340XPE6
LinkDB
Position
Un
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVTCNTSWKINLFMQFREHLEAVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGAQGRAGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKTPFRDKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSLEYLSIEYSEEEVWLMWTDKNNEHHEKSIRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLSASRDDKKNKFASTMEFVEDY
LSSVASEAAPFASEEKSKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQVYEDPGGKNVRRSIQGVGHMMSTMVLTRKQSVFGAPSLPAGAGTPEPLDRSKFEENE
NIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDNGADGTAPAFDSAT
ASMNLDRIREQAEAMFGVGRTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFEQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPADEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNTGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEIGEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKTARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRLSDPTLERFVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGASCAV
AAQRNVSNYKTAPRAFPRVTPTPNQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAHQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSSSRGDLPDPMGTGLDQDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIRLLDGGNTEIQKSFHNLMTSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMSDLGSQPREDREPADPTAKGRVASFWMPSSSSRYSLGPSLRQGHEVGERVQS
NEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSDVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNRQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFGQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYVEGASTGVLGSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDVEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPSNHSRASPLGMPHGAATFVDTCSGDNIDCVSGVVVPEVLAEDEELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHITFEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCMSR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagcgagatgtccagcttcctccacatcggggacatcgtctccctgtacgccgagggc
tcagtcaatggcttcatcagcactctggggttggtggatgaccgctgtgtcgtggagccc
gcggctggggacctggacaaccctcctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagattgccgacgtggtgctgctgcagaagttacagcatgcggcccagatggag
cagaagcagaatgacacagagaacaagaaggtgcatggggacgtcgtaaagtacggcagt
gtgatccagctcctgcacatgaaaagtaacaagtacctgaccgtgaacaagcggctgccg
gccctgctggagaagaacgccatgcgggtgacactggatgccacgggcaacgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaatgtggttgtcggg
gacaaggtgatcctgaaccctgtcaatgctgggcagcctctgcatgccagcaactatgag
ctcagcgacaatgctggctgcaaggaggtcaactctgtgacctgcaacaccagctggaag
atcaacctgtttatgcagttccgagagcacctggaggcggtgctgaaagggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacgtgcgatgagtacaagggcaag
ctgcaggtcttcctgcgcaccacgctgcgccagtccgccacctcggccaccagctccaat
gccctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctggccactgg
aacggcctgtaccgcttcaagcacctggccacgggcaactacctggctgctgaggagaac
cccagctacaagggtgacgcctctgatcccaaggcagcgggaacgggtgcccagggccgc
gcaggtcgccggaacgctggggagaagatcaaataccgcctggttgctgtgccccacggc
aatgacattgcttctcttttcgagctggatcccaccacgctgcagaaaaccgactccttt
gtgccccggaactcgtatgtccggctgcggcacctctgcaccaacacgtggatccagagc
accaacgtgcccattgatgtcgaggaggagcgacccatccggctcatgctgggcacgtgc
cccaccaaggaggacaaggaggccttcgccattgtgtcggttcctgtgtccgagatccga
gacctggactttgccaatgacgccagctccatgctggccagtgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcagatttgttatccagctgctggaggacctggtg
ttcttcgtcagcgacgtccccaacaacgggcagaacgtgctggacatcatggttaccaag
cccaaccgggagcggcagaagctgatgagagagcagaacatcctcaaacagatctttggc
attctgaagaccccgttccgtgacaaggggggtgagggccccctggtgcggctggaggag
ctgtcggaccagaagaacgccccctaccagcacatgtttcgcctgtgctaccgtgtgctg
cgccattcccaggaggactaccgcaagaaccaggagcacatcgccaagcagttcgggatg
atgcagtcccagatcggctacgacatcctggccgaagacaccatcacggccctgctgcac
aacaaccgcaagctcctggagaagcacatcaccaagacggaggtggagaccttcgtcagc
ctggtgcggaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccctgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccagaccgagcttcggcccgtgaaggagatggcgcagtccctt
gagtacctgagcatcgagtactcagaggaggaagtgtggctcatgtggaccgacaagaac
aacgagcaccatgagaagagcatcaggcagctggcccaggaggcacgggccggcaacgcc
cacgatgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ctggaccggcagtacctggccatcgatgagatctctcagcagctgggcgttgacctcatc
ttcctgtgcatggcggacgagatgctgccctttgacctgcgtgcctccttctgtcacctg
atgctgcatgtgcacgtggaccgtgacccccaggaactggtcacgcccgtcaagttcgcc
cgcctctggactgagatccccacggctatcaccatcaaggactatgattccaacctcagc
gcctcccgggatgacaagaagaacaagtttgctagcaccatggagttcgtggaggactac
ctcagcagcgtggccagcgaggccgcgccctttgccagcgaggagaagagcaagctcacc
tttgaggtggtcagcctggcgcacaacctcatctactttggcttctacagcttcagcgag
ctgctgcggctcacacgcactctgctgggcatcatcgactgcgtgcagggccccccagcc
atgctgcaagtctatgaggacccaggcggcaagaatgtgcggcggtccatccagggagtg
gggcacatgatgtccaccatggtgctgacccgcaagcagtctgtctttggcgcccccagc
ctgcctgccggcgccggtacccctgagccactggacagaagcaagtttgaggagaatgag
aacattgtggtgatggagaccaaactgaagatcctggaaatcttgcagttcatcctcaac
gtccgcctggattaccgcatctcatacctgctgtccgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacaacggggctgatggcacagccccggccttcgactccgcgacc
gccagcatgaacctggaccgcatcagggagcaggcggaggccatgtttggagtggggagg
acgagcagcatgctggaggtggacgacgagggtggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactacgcgcccctggtctcgggggccctgcagctcctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcgagcaggtgcagctgctgatctca
gcccaggacgtggagaactataaggtgatcaagtcggagctggaccggctgcggaccatg
gtggagaagtcggagctgtgggtggacaagaagggcagcggcaagggcgaggaggtggag
gcaggcgccgccaaagacaagaaggagcggcccgcggacgaggagggcttcctgcacccg
cctggggagaagagcagcgagaactaccagatcgtcaagggcatcctggagcggctgaac
aagatgtgtggcgtcggggagcagatgaggaagaaacagcagcggctgctcaagaacatg
gatgcccacaaggtcatgctggacctgctgcagatcccctatgacaagggcgatgccaag
atgatggagatcctgcgctacacacaccagttcctgcagaagttctgcgctgggaacacc
ggcaaccaggcgctgctgcacaagcacctgcacctcttcctcacgccagggctgctggag
gcggagaccatgcagcacatcttcctgaacaactatcagctgtgctccgagatcggcgag
cccgtgttgcagcacttcgtgcacctgctggccacccacgggcgccacgtgcagtacctg
gacttcctgcacaccgtcatcaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgaccgagctgaccaacgcaggtgacgacgtggtcgtgttctacaacgacaaggcc
tcgctggcccacctgctagatatgatgaagactgcccgggacggcgtggaggaccacagc
cctctcatgtaccacatctccctggtggacctgctggccgcctgcgccgagggcaagaac
gtctacaccgagatcaagtgcacgtccctgctgcccctggaggatgtggtgtctgtggtg
acacatgaggactgcatcactgaggtgaaaatggcctacgtgaactttgtgaaccactgc
tacgtggacacggaggtggagatgaaggagatctataccagcaaccacatctggacactc
tttgagaacttcaccctggacatggctcgggtctgcagtaagcgtgagaagcgcctgtct
gaccccaccctggagaggtttgtgctgaccgtcgtgctggacaccatcagcgccttcttc
agctccccgttctccgagaacagcacctccctgcagacacaccagacgatcgtggtgcag
ctgctgcagtccaccacacggctgcttgagtgtccgtggctgcagcagcagcacaagggt
tctgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatctcgctg
cccatggacctggatgcccacatcagctcgctgctcagcagtggtgccagctgtgcagtt
gccgcccagcggaacgtctctaactacaagacggccccgcgggccttcccccgcgtcaca
cccacccccaaccagtgggactacaagaacatcatcgagaagctgcaggacatcatcacg
gccctggaggagcggctgaagcccctagtgcaggccgagctgtccgtgctggtggacgtc
ctgcactggcccgagttgctttttctggagggcagtgaggcccaccagcgctgtgagagt
ggaggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcagaggagaag
ctgtgtgtcaaggtgctgaggacgctgcagcaaatgctgcttaagaagaccaagtatggg
gaccggggcaaccagctgcgcaaaatgctgctgcaaaactacctccagaaccggaagtcc
agctcgcggggggaccttccagaccccatgggcaccggcctggaccaagactggtcagcg
atcgcagccacccagtgccggctggacaaggagggggccaccaagctggtgtgtgacctc
atcaccagcaccaagaatgagaagatcttccaggagagcattggcctggccatccgcctg
ctggacggtggcaacaccgagatccagaaatccttccacaacctgatgacgagcgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacagtggccgtcaacatgagcgacctgggcagccagccgcgggaggaccgggag
ccagcagaccccaccgccaaaggccgcgtggcctccttctggatgcccagctcctcatcc
cgctattcgctgggccccagcctgcgccaggggcatgaggtgggcgagcgcgtgcagagc
aacgagatgggcacgtccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgcgagaaccacaaccgggacctgcagaacttcctgcgctgccagaacaacaagaccaac
tacaacctggtgtgcgagactctgcagttcttggacatcatgtgcggcagcaccacgggc
ggtctggggctgctggggctctacatcaacgaggacaacgtgggcctcgtcatccagacc
ctggagaccctcacagagtattgccagggcccctgccacgagaaccagacctgcatcgtg
acgcacgagtccaatggcatagacatcatcaccgcactgattctcaatgacatcagtccc
ctgtgcaagtaccgtatggacctggtgctgcaactcaaggacaacgcctccaagctgctc
ctggctctgatggagagccggcacgacagtgaaaacgccgagcgcatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaggagcgtgag
aactcggacgtgagccctcgtgaagtgggccacaatatctacatcctggcgctgcagctc
tccaggcacaacaagcagctgcagcacctgctgaagcccgtgaagcgcatccaagaagag
gaggccgagggcatctcttccatgctcagcctcaacaacaggcagctgtcacagatgctc
aagtcctcagcaccggcacaggaggaagaggaggaccccctggcctactatgagaaccac
acgtctcagatagagatcgtgcggcaggaccgcagcatggagcagatcgtgttcccggtg
cctggcatctgccagttcctgacggaggagaccaagcaccggctcttcaccaccaccgag
caggatgagcagggcagcaaagtgagcgacttcttcggccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccactcatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggcggtttttatcaacatcatcatcgcc
ttcttctacccctacgtggagggcgcatccacaggtgtgctgggctcccccctcatctcg
ctgctgttctggatcctcatctgcttctccatcgcggccctgttcaccaagcgctatagc
atccgccccctcatcgtggcgctcatcctgcgctccatctactacctgggcattgggccc
acgctcaacatcctgggtgccctcaacctgaccaacaagatcgtgttcgtggtgagcttt
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacgtggagttc
ctgtaccatgtgggctacatcctgacgagtgtcctgggcctctttgcccatgagctcttc
tacagcatcctgctctttgacctcatctaccgcgaagagacgctgttcaatgtcatcaag
agtgtgacccgcaacggccgctccatcctgctgaccgccctgctggccctcatcctggtc
tacctcttctcgattgttggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccagcaaccactccagagccagccccctggggatgccacatggagctgccaca
tttgtggacacttgcagtggggacaacatagattgtgtctcaggggtcgtggtgcccgag
gtcctggcagaggatgaggagctggacagcacggagcgggcctgtgacaccctgctcatg
tgcatcgtcactgtcatgaaccacgggctgcgcaatggtggcggtgtgggcgacattctc
cgcaagccctccaaagacgagtctctcttcccggcccgcgtggtctatgacctcctgttc
ttcttcatcgtcatcatcatcgtgctgaacctcatctttggggtgatcatcgacaccttt
gccgacttgcgcagtgagaagcagaagaaggaagaaatcctcaagaccacgtgcttcatc
tgtggcctggagagggacaagttcgacaacaagacggtgtcgtttgaggagcacatcacg
ttcgagcacaacatgtggaactacctgtacttcatcgtgctggtccgtgtgaagaataag
acggactacacgggacccgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcactggtgagcaacgagggggagggggagcagaat
gagatccggattcttcaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgaactcaaggagcagatgacggagcagcggaaacgcaggcaacgcttg
ggcttcgtggatgtccagaactgcatgagccgctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078697
Entry
103078697         CDS       T03090                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04114  Oocyte meiosis
lve04210  Apoptosis
lve04218  Cellular senescence
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04621  NOD-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103078697 (ITPR2)
   04020 Calcium signaling pathway
    103078697 (ITPR2)
   04070 Phosphatidylinositol signaling system
    103078697 (ITPR2)
   04022 cGMP-PKG signaling pathway
    103078697 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103078697 (ITPR2)
   04210 Apoptosis
    103078697 (ITPR2)
   04218 Cellular senescence
    103078697 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103078697 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103078697 (ITPR2)
   04621 NOD-like receptor signaling pathway
    103078697 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    103078697 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103078697 (ITPR2)
   04929 GnRH secretion
    103078697 (ITPR2)
   04912 GnRH signaling pathway
    103078697 (ITPR2)
   04915 Estrogen signaling pathway
    103078697 (ITPR2)
   04921 Oxytocin signaling pathway
    103078697 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    103078697 (ITPR2)
   04918 Thyroid hormone synthesis
    103078697 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    103078697 (ITPR2)
   04924 Renin secretion
    103078697 (ITPR2)
   04925 Aldosterone synthesis and secretion
    103078697 (ITPR2)
   04927 Cortisol synthesis and secretion
    103078697 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103078697 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    103078697 (ITPR2)
   04971 Gastric acid secretion
    103078697 (ITPR2)
   04972 Pancreatic secretion
    103078697 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103078697 (ITPR2)
   04725 Cholinergic synapse
    103078697 (ITPR2)
   04728 Dopaminergic synapse
    103078697 (ITPR2)
   04726 Serotonergic synapse
    103078697 (ITPR2)
   04720 Long-term potentiation
    103078697 (ITPR2)
   04730 Long-term depression
    103078697 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    103078697 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103078697 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103078697 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103078697 (ITPR2)
   05012 Parkinson disease
    103078697 (ITPR2)
   05017 Spinocerebellar ataxia
    103078697 (ITPR2)
   05020 Prion disease
    103078697 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    103078697 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103078697 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103078697 (ITPR2)
   05163 Human cytomegalovirus infection
    103078697 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103078697 (ITPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103078697 (ITPR2)
Ion channels [BR:lve04040]
 Ligand-gated channels
  IP3 receptor
   103078697 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207 Sec2p
Other DBs
NCBI-GeneID: 103078697
NCBI-ProteinID: XP_007446345
UniProt: A0A340WH28
LinkDB
Position
Un
AA seq 2701 aa
MSDKMSSFLYIGDIVSLYAEGSVNGFINTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQVKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNMRDGDLPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQDVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKLVSMQGDNPKESVILSDDIDEEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCMSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGELMTQMVLCRGSIFPMSVPDIQPSLHPSKQGSPAE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGENNGNAETSTNGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDERGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSSYENGE
MGENQVKGGEEPIEDSNILSPVQDGTKKPQIDSNKRNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
HSFLTPGLLEAETMRHIFMNNYHLCNEISERVIQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPTLLHMMCSERDRGDESGPLAYHVTLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADTFLEKCVTESIMNVVSGFFNSPFSDNST
SLQTHQPVFIQLLQSVFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDGQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPSWDYRNIIEKLQDVVGSLEQQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCIKILQTLRE
MLEKKDSFVEEGTTLRKILLNRYFRGDYGVCMNGHLSGAYCKSAQGGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGILLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGSRMRVRDSSLHLK
EGMKGQLTEASSATSKAYCAYRREMDPEIDIMCTGSEAGNAEEKSAEEVTVSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVVLVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVVKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGSDPDGGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRSNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAVCTSMLFF
FSKPVGIRPFLVSVMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPLTGSNAVSGMTLTSILGTCEKDNCSPT
IPASNTAAEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKEEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFLVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRNLQEKLESTMSLVRQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgtccgataaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcaacacgctggggctagtggatgacagatgtgtggtacac
ccagaggcgggggacctcgccaaccctcccaagaagttccgagactgcctctttaaggtg
tgccctatgaaccgatattctgctcagaaacagtattggaaagccaagcaagttaaacaa
gggaaccacacagaggcagccttgctgaagaaattacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaagctgttgggagaaattgtgaaatatagtaatgtt
atacaactactgcatataaaaagcaacaagtatctgactgtcaacaagagattacccgct
ttactggagaagaatgccatgcgcgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatcccttctggaagctgagaagcgagggtgacaatattgttgttggagat
aaagttgttttgatgcccgtgaatgcaggacagccactacatgccagcaacatagagctt
ctcgataatccagggtgtaaagaggtgaatgctgttaattgcaacactagctggaaaatc
actctattcatgaaatatagttcctatcgagaggatgtactgaaagggggtgatgttgtt
cggttgtttcatgcggaacaagagaagtttctgacttgtgacgaatatgagaaaaaacag
cacattttccttcgtacaactttgcgtcaatcagccacttctgctaccagttctaaagca
ctctgggaaatagaggtagttcatcatgacccatgccgtggaggtgcaggacaatggaac
agcttgttcaggtttaaacatcttgcaaccgggaactatttagctgcagagcttaaccct
gattatcgagatgcccaaaatgaaggaaaaaatatgagagatggagatcttccaacttca
aagaagaaacgccaggcaggggagaagatcatgtacactttggtctcagtcccacatgga
aatgacattgcatccctctttgaactggatgccacaactcttcagagagcggactgcctg
gtcccaaggaattcatacgtccggttaagacatttatgtacaaacacgtgggtaaccagt
actagcatccccatagacacagatgaagagaggcctgttatgttgaagatcggaacttgc
caaacaaaagaagataaagaagcttttgccattgtgtctgttccgctgtctgaggtccga
gacttagacttcgccaatgacgcaaataaagtgctggcgaccacagttaaaaagctggaa
aacggcacaataactcagaatgaaaggaggtttgtgaccaaattattggaagaccttatt
ttctttgttgctgatgtacctaacaatggacaagatgttctggatgtggttatcaccaag
ccaaaccgagaacgtcagaaattaatgagggaacaaaacatattggcacaggtatttgga
attctgaaagcaccctttaaggagaaagcaggagaaggctcaatgctgagacttgaggat
ctgggggatcaaagatatgccccctacaagtacatgctgaggctgtgctaccgtgtgctg
agacattcacagcaggactacaggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcacagattggctatgatattttggcagaagataccatcacagctttgttgcac
aacaacagaaaactactagagaaacacatcacagcaaaagaaatagaaacatttgttagt
ttactcaggagaaatcgggagccaaggtttttggattatttatcagatctctgtgtgtct
aacaccaccgctatacctgtaactcaagaactcatctgcaaatttatgttgagcccgggc
aatgcagatattctcattcaaactaagctggtctcaatgcaaggagacaaccccaaggag
agtgtcatcctttcagatgacattgatgaggaagaagtttggctctactggattgacagc
aacaaggaacctcatggcaaagctatcaggcaccttgctcaggaagcaaaagaaggcacc
aaggctgatttagaagttcttacctactacaggtaccagctaaatctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacgcagctctctgttgatttg
atcctgcgatgtatgtcagatgagagcctgccctttgacctccgagcatctttttgtcgc
cttatgctgcacatgcatgttgaccgggatccccaggagtctgtggtgcctgttcgctat
gccaggctctggacagaaatccccacaaagatcacgattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgcactgacaatggaatttgttgaagaa
tacttgaaagaggttgtaaatcagccttttccttttggagataaagaaaaaaacaaactg
acgtttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gaattattaaggctaacaaggacacttctggctatccttgacatcgttcaggcccccatg
tcatcgtattttgaaagattaagcaaatttcaagatggaggaaacaatgtcatgagaacc
atccatggggtgggagaattgatgacccagatggtgctttgcagaggttccatcttcccc
atgagtgtgcctgacatccagcccagcctgcatcccagcaagcaggggagccccgccgag
cacgaggatgtcactgtcatggacaccaagctgaagattattgagattttacagtttatc
ctgagtgtcagactggattataggatctcatatatgctgtcaatatataagaaggaattt
ggggagaacaatggaaatgctgaaacgtccaccaatggctctcccgatacattgctgcca
tcagctattgttcctgacatagatgaaattgcagctcaggcagaaactatgtttgctgga
agaaaggaaaaaaatccagttcaacttgatgatgaaagaggcaggacatttttacgggtc
ctcattcatctgatcatgcatgactaccctcctttgctatcaggagccctgcagctgctg
ttcaagcacttcagccagagagcggaagttttacaggcatttaaacaggtgcagttactg
gtgtccaatcaggacgtagataactacaagcaaatcaaggcagacctagaccagcttcga
ctaactgtagaaaaatccgagttatgggttgagaagagcagcagctatgagaatggagaa
atgggtgaaaatcaagtaaaaggtggtgaagagccaattgaggactcaaacattttaagt
ccagtgcaagatggaacaaagaaacctcagattgacagcaataagaggaacaactaccgg
attgtaaaggagattttgattaggctaagtaaactctgtgtacagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggagctcattcagtggtgttagacctgctg
cagataccctatgaaaagaatgatgaaaagatgaatgaagtaatgaatctggcgcataca
ttcctgcagaatttctgtcggggaaatccgcagaatcaagtcctcctccataaacacctg
cattcgttcttaacccctggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattatcatctgtgcaatgaaattagcgagagggttatccagcacttcgtgcactgcatt
gagacacacggccgccacgtggagtacctgaggtttctgcagacgattgtcaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtgatgaccgagctgataaatgggggtgaa
gatgtgctgatattttacaatgatagagcatcatttcccacccttctccatatgatgtgt
tcagagagggaccgaggggatgagagtggccccttagcctaccatgtcacgcttgtggag
ttgctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgcaattccctt
ctgcccctggacgacatagtgagggtggtgacccatgatgactgcatccctgaggttaaa
attgcttatgtgaattttgttaatcactgttacgttgacactgaagtggaaatgaaagaa
atctacacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacacgcagacacctttttggagaagtgtgttact
gagtcaatcatgaacgttgtgagcggcttttttaattctcccttttcagacaacagtacc
agcctgcagacacatcagccagtttttattcagctgcttcagtcagtcttcagaatttac
aattgcacctggccaaatccggcacagaaagcctcggtggagtcctgtatcagaactttg
gccgaagtggcaaagaatcgtggaattgccattccagtggatttggacggccaagttaat
actctttttatgaagagtcattccaatatggtgcagagagcggccatgggttggagacta
tcagctcgttctggaccacgctttaaggaagctcttggagggccttcttgggattataga
aatattattgaaaagttacaggatgtagtagggtccttggagcaacagttcagcccgatg
atgcaggctgaattctctgtgttggttgatgtgctgtacagcccagagctactgtttcct
gaggggagcgatgcaagaataagatgcggtgctttcatgtccaagttgatcaatcataca
aagaaactgatggagaaagaagaaaaattgtgcattaaaattcttcaaactttacgagaa
atgctggagaagaaagacagctttgtggaagagggtactacattaagaaaaatactcctg
aatcggtactttagaggcgattatggtgtctgtatgaacggacacctctctggagcctac
tgcaaatctgcacaaggaggaggaagcttttctggacaagattcagataagatggggata
tccatgtcagatattcagtgtctactggataaagaaggtgcatctgaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcggaaggcattttacttggcattgcc
ttgcttgaaggaggaaatacacaaactcagtattccttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattcttcaaagttctctatgaccgaatgaaggctgctcagaaagag
ataagatcaacagtgacagttaataccatagacttaggtaacaaaaaaagggatgatgac
aacgaattgatgacatctggctcacgcatgagagtaagagattcatcattacatttaaaa
gagggaatgaaaggccaattaacagaagcttcttcggcaacatccaaagcatactgtgcg
tacagaagagaaatggatccagaaatagacatcatgtgcacaggatcagaagcgggaaac
gctgaggaaaagtctgcggaggaagtaacagtgagtcctgccattgccatcatgcagccg
attctgagatttcttcagttactctgtgagaatcacaaccgggaactgcagaatttcttg
aggaatcaaaacaacaaaacaaattacaaccttgtctgtgagacccttcagtttttggac
tgcatttgtggaagtacgacgggtggcctgggcctcttgggtctctacatcaatgagaag
aatgtagtgctggtcaaccagactctggagagcttgactgagtattgccagggcccatgc
catgaaaatcagacatgtattgctactcatgaatctaatgggattgatatcatcattgct
ttgattctaaatgacataaaccctcttggtaaatatcgaatggacctggtgctccaacta
aagaacaatgcctccaagcttttgctggccatcatggaaagtagacatgacagtgagaat
gcagaaagaattctatttaacatgagacccagagaactggtggatgtggtgaagaatgcc
tataaccaaggattggaatgtgatcatggggatgatgagggcggagatgatggtgtttcc
ccaaaagatgttggacacaatatctatattctggcccatcagttggcacgccacaacaaa
ctcttgcagcagatgctcaaaccaggatccgatccagatggcggagatgaagccttaaag
tattatgccaaccacactgcacagatcgagattgttcggcatgataggacaatggaacaa
atagtgtttcctgtccccaatatatgtgaatacctcacgcgagagtccaagtgccgtgtg
ttcaataccacggaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaacg
gaagatctctacaatgagatgaagtggcagaagaaaatcaggagtaatcctgccctgttc
tggttctcaaggcacatttctctctgggggagcatctccttcaacctggctgtgttcatc
aacttagctgtggctctcttctacccatttggggatgatggagatgaaggtacactttca
ccattgttctcagttctgctttggatagcagttgcagtctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccatttcttgtgtcagtaatgctcagatcaatatat
acaataggtcttgggcctacgttaatacttcttggtgcagctaatctttgtaataaaata
gtatttctggtgagttttgtcggaaatcgtggcacgttcacccgagggtaccgagcggtc
atcctggatatggcctttctctaccatgtagcgtatgtcctggtttgcatgctgggcctc
tttgttcacgaattcttctatagcttcctgctttttgatttagtatacagagaagagact
ctgctcaatgtcataaaaagtgtcacacggaatggccgctccattattctaactgcagtc
ctcgccctcatccttgtctacctgttttccattattggattcctttttctgaaggatgac
ttcactatggaggtggataggctgaaaaacagaactccccttacaggtagcaatgcagtt
tctggtatgactttaacttcaatcctgggaacatgtgaaaaggacaactgctcacccaca
ataccagcttcaaatacagctgctgaggaatatgaagatggaattgaaagaacgtgtgac
accctccttatgtgcatcgtgactgtcctgaaccagggcctcaggaacggcggtggtgtg
ggagatgtgctgagaagaccctcaaaagaagaacccttgtttgctgcccgagtggtgtat
gaccttcttttttatttcattgtcatcattatcgttcttaacttgatttttggggttatc
attgatacttttgcggatctcagaagtgaaaaacagaaaaaagaagaaattctaaagaca
acctgcttcatctgtggactcgagagggacaagtttgataataaaacggtttcttttgag
gagcacatcaagtcagaacacaatatgtggcattatttgtacttcctagtcctggtgaag
gtgaaagacccaactgaatacaccggacctgaaagttacgtggctcaaatgattgtggag
aagaatttggactggtttcctcggatgagagctatgtcccttgttagcaatgaaggtgac
agtgaacaaaatgagattcggaacctgcaggagaagttggaatcgaccatgagtctggtc
agacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggctttctcggatcaaacacaccccatgtgaatcatcacatgccaccg
cactga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079294
Entry
103079294         CDS       T03090                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04114  Oocyte meiosis
lve04140  Autophagy - animal
lve04210  Apoptosis
lve04218  Cellular senescence
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04621  NOD-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103079294 (ITPR1)
   04020 Calcium signaling pathway
    103079294 (ITPR1)
   04070 Phosphatidylinositol signaling system
    103079294 (ITPR1)
   04022 cGMP-PKG signaling pathway
    103079294 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103079294 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103079294 (ITPR1)
   04210 Apoptosis
    103079294 (ITPR1)
   04218 Cellular senescence
    103079294 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103079294 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103079294 (ITPR1)
   04621 NOD-like receptor signaling pathway
    103079294 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    103079294 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    103079294 (ITPR1)
   04929 GnRH secretion
    103079294 (ITPR1)
   04912 GnRH signaling pathway
    103079294 (ITPR1)
   04915 Estrogen signaling pathway
    103079294 (ITPR1)
   04921 Oxytocin signaling pathway
    103079294 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    103079294 (ITPR1)
   04918 Thyroid hormone synthesis
    103079294 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    103079294 (ITPR1)
   04924 Renin secretion
    103079294 (ITPR1)
   04925 Aldosterone synthesis and secretion
    103079294 (ITPR1)
   04927 Cortisol synthesis and secretion
    103079294 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103079294 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    103079294 (ITPR1)
   04971 Gastric acid secretion
    103079294 (ITPR1)
   04972 Pancreatic secretion
    103079294 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103079294 (ITPR1)
   04725 Cholinergic synapse
    103079294 (ITPR1)
   04728 Dopaminergic synapse
    103079294 (ITPR1)
   04726 Serotonergic synapse
    103079294 (ITPR1)
   04720 Long-term potentiation
    103079294 (ITPR1)
   04730 Long-term depression
    103079294 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    103079294 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103079294 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103079294 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103079294 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103079294 (ITPR1)
   05012 Parkinson disease
    103079294 (ITPR1)
   05016 Huntington disease
    103079294 (ITPR1)
   05017 Spinocerebellar ataxia
    103079294 (ITPR1)
   05020 Prion disease
    103079294 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    103079294 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103079294 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103079294 (ITPR1)
   05163 Human cytomegalovirus infection
    103079294 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103079294 (ITPR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103079294 (ITPR1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103079294 (ITPR1)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103079294 (ITPR1)
Ion channels [BR:lve04040]
 Ligand-gated channels
  IP3 receptor
   103079294 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 103079294
NCBI-ProteinID: XP_007453130
UniProt: A0A340X1W6
LinkDB
Position
Un
AA seq 2744 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPEAGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANNTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAELDSDQDASRSRLRNAQEKMVYSLVSVPEGNDISSIFELDPTTL
RGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGTSPVKEDKEAFAIVPV
SPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVL
EVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEELGDQRHAPFRHICRL
CYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLHNNRKLLEKHITAAEI
DTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPTNADILIETKLVLSRF
EFEGVSTGENALEAGEDEEEVWLFWRDSTKEVRSKSVRELAQDAKEGQKEDRDVLSYYRY
QLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRASFCRLMLHMHVDRDPQ
EQVTPVKYARLWSEIPSEIAIDDYDSSGTSKDEIKERFAQTMEFVEEYLRDVVCQRFPFS
DKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVHVTTIFPISKMAKGEEN
KGENNVVKVRSSNVMRSIHGVGELMTQVVLRGGGFLPMTPTATAPEGNVKQAEPEKEDIM
VMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSETSSGNSSQEGPSNVPG
ALDFEHIEEQAEGIFGGRKENTPLDLDDHGGRTFLRVLLHLTMHDYPPLVSGALQLLFRH
FSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSELWVYKGQGPDEAMDRA
SGENEHKKTEEGNNKSQKHESTSSYNYRVVKEILIRLSKLCVQEGTSVRKSRKQQQRLLR
NMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQNQALLHKHINLFLNPG
ILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIKFLQTIVKAEGKFIKKC
QDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSPLMYHIHLVELLAVCTE
GKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCYVDTEVEMKEIYTSNHM
WKLFENFLVDICRACNNTSDRKHADSVLERYVTEIVMSIVTTFFSSPFSDQSTTLQTRQP
VFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAIPVDLDSQVNNLFLKSH
NIVQKTAMNWRLTARNAARRDSVLAASRDYRNIIERLQDIVSALEDRLRPLVQAELSVLV
DVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKLCIKVLQTLREMMTKDR
GYGEKLISIDELDNAELPQAPASENSTEEVEPSPPLRQLEDHKRGEALRQILVNRYYGNI
RPSGRRESLTSFGNGPLSPGGPGKPGGGGGGSGSSSMSRGEMSLAEVQCHLDKEGASNLV
IDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDKKSEKFFKVFYDRMKVAQ
QEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPATQITEEVRDQLLEASAATKKAFT
TFRREADPDDHYQSGEGAQATADKTKDDLEMSAVITIMQPILRFLQCLCSPNLGTAQLQN
FLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVALINQTLESLTEYCQG
PCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNNASKLLLAIMESRHDS
ENAERILYNMRPKELVEVIKKAYMQGDVEFEDGENGEDGAASPRNVGHNIYILAHQLARH
NKELQTMLKPGGQVEGDEALEFYAKHTAQIEIVRLDRTMEQIVFPVPSICEFLTKESKLR
IYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCARNMSFWSSISFNLAVL
MNLLVAFFYPFKGVRGGTLEPHWSGLLWTAMLISLAIVIALPKPHGIRALIASTILRLIF
SVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFTRGYRAMVLDVEFLYHLLYLLICALGL
FVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRSIILTAVLALILVYLFSIVGYLFFKDD
FILEVDRLPNETSLPEASESLASEFLYSDVCRVETGENCSSPAPKEERVPAEETEQDKEH
TCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEEPLFAARVIYDLLFFFMVIIIVLNLIF
GVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVTFEEHIKEEHNMWHYLCFIV
LVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRAMSLVSSDSEGEQNELRSLQEKLESTM
KLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPPHMNVNPQQPA
NT seq 8235 nt   +upstreamnt  +downstreamnt
atgtctgacaagatgtctagtttccttcatatcggagacatttgttctctgtacgccgag
ggatcgacaaatggatttattagcaccttgggcctggttgatgatcgttgtgttgtacag
ccagaagctggggaccttaacaatccacccaagaaattcagagattgcctctttaaatta
tgtcccatgaatcgctactccgcccagaagcagttctggaaggctgctaagccaggagcc
aacaacacgacagacgcagtactacttaacaaactacaccatgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtgatccagtatggcaatgtg
atccagctcttgcatttgaaaagtaataaatacctaacagtgaataagaggcttccagct
ctgctggagaagaatgccatgagagtaacgttggacgaggctggcaacgaagggtcctgg
ttttacattcagccattctacaagctgcgatccatcggagacagtgtggtcataggtgac
aaggttgttctgaaccccgtgaatgctggccagcccttacatgccagcagtcatcagctg
gtggataacccaggctgcaacgaggtcaattccgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagatgacatattaaaggggggtgacgtggtg
aggctgttccacgccgagcaggagaagtttctcacctgtgacgagcacaggaagaagcag
catgtcttcctgagaactactggccggcagtcagccacatctgccactagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccgtgtcggggtggagcaggatattggaac
agcctcttccgtttcaagcatcttgctacagggcattacttagcagcagagctggactct
gatcaggatgcctcccggagcaggttgcgaaacgcccaagaaaagatggtgtactccctg
gtctctgtgcccgaaggcaatgacatctcctccatctttgagctagatcccaccaccctc
cgtggaggcgatagccttgtcccaagaaactcatatgtccggctcagacacctgtgtact
aatacctgggttcacagcacaaatatccccattgacaaggaagaagaaaaacccgtgatg
ctaaaaattggaacctctcccgtgaaggaggacaaagaagcatttgccatagttccagtc
tctcctgctgaggttcgggacctggactttgccaatgatgccagcaaggtgctgggctcc
atagctgggaagctggagaagggcaccatcacccagaatgaaagaagatctgtaaccaag
ctgcttgaagacttggtttactttgtcactggtggaactaattccggtcaagatgttctt
gaagtggtcttctctaagcccaacagagaacggcagaagctgatgagagaacagaatatt
ctcaagcagatcttcaagttgttacaggccccattcacagactgtggtgacggcccgatg
ctacgtctggaggagctgggggaccagcggcatgcacccttcagacacatctgccgcctc
tgctacagggtcctgagacactcccagcaggactacaggaagaaccaggagtacatagcc
aagcagtttggcttcatgcagaagcagattggctatgatgtgctggctgaagacaccatc
actgccctgctccacaataatcggaaactcctggaaaaacacatcactgcggcggagatc
gacacctttgtcagtctggtgcgaaagaacagggagcccagattcttagattacctctct
gatctctgcgtgtccatgaacaaatccattccggtgacccaggaactgatatgtaaagct
gtgctgaatccaaccaacgctgacattctgattgagaccaagttggtactctctcgtttc
gaatttgaaggtgtttctactggagagaacgctctggaggcaggagaggatgaggaagag
gtgtggctgttctggagggacagcaccaaagaggttcgcagtaagagtgtgagggaactg
gcgcaggatgctaaggaggggcagaaagaagaccgagacgtcctcagctactacaggtac
cagctgaacctctttgcgaggatgtgcctggaccgccagtacctcgccatcaacgaaatc
tcaggccagctggacgtggatcttattctccgctgcatgtctgatgagaacctgccctat
gacctgcgggcgtccttctgccgtctcatgctccacatgcatgtggaccgagacccacag
gagcaagtcactcccgtgaaatacgcccgcctctggtccgagattccctccgagatcgcc
attgatgactatgatagtagtggcacttccaaagatgaaattaaggagaggtttgctcag
accatggaatttgtggaggagtatttaagagatgtggtgtgtcagaggttccctttctct
gataaggagaaaaataaacttacatttgaggttgtaaatttagctaggaatctcatatac
tttggtttctacaacttctctgaccttctgcgattaaccaaaatcctcctggccatattg
gactgtgtgcacgtgaccacaatcttccccatcagcaagatggcgaagggagaggagaat
aaaggtgagaataacgtggtgaaggtgaggagtagtaacgtgatgcggtccatccatggg
gttggagagctgatgacccaggtggtgctccggggaggaggcttcctgcccatgactccc
acggccaccgcccctgagggcaatgtgaagcaagcagagccggaaaaggaggacatcatg
gtgatggacaccaagttgaagatcattgaaatactccagtttattttgaatgtgaggttg
gattataggatctcctgcctcctgtgtatatttaagcgggagtttgatgaaagcaattcc
cagacttcggaaacatcctccggaaacagcagccaggagggaccaagtaatgtaccaggt
gctcttgattttgaacacattgaagagcaagccgaaggcatctttggaggaaggaaagag
aacacgccactggacctggacgaccacggcggcagaaccttcctccgggtcctgctgcat
ttgacaatgcacgactacccacccctggtgtcaggggccctgcagctcctctttcggcac
ttcagtcagaggcaggaggtcctgcaggccttcaaacaggttcaactgcttgttaccagc
caagatgtcgacaactacaaacagatcaaacaagacttggaccaactgcgatccatcgtg
gagaagtcagagctttgggtgtacaaagggcagggccccgacgaggccatggaccgtgca
tctggtgaaaatgaacataagaaaacagaggaggggaataacaagtcccagaagcatgag
agcaccagtagctacaactacagggtggtcaaagagattttgattcgactcagcaaactc
tgtgtccaagagggcacctctgtgaggaagagccggaagcagcagcaacgcctgctccgg
aacatgggagcccacgccgtggtgctggagctgctgcagatcccctacgagaaggccgaa
gacaccaagatgcaggagataatgaggctggctcacgagtttctgcagaatttctgtgct
ggcaaccagcagaatcaggctttgctccacaaacatataaacctgtttctcaacccaggg
atcctggaggcggtcacgatgcagcacatcttcatgaacaatttccagctgtgtagtgag
atcaacgagagagtcgtccagcactttgttcactgcattgagactcacggtcgaaacgtc
cagtacatcaagttcttgcaaacgattgtcaaggccgaagggaaattcatcaaaaagtgc
caagacatggtcatggctgagctggttaattcaggagaggatgtcctcgtattctacaac
gacagagcctctttccagactctgatccagatgatgaggtcggaacgggaccggatggat
gagaacagccctctcatgtaccacatccacctggtcgagctcttggccgtgtgcacagag
ggcaagaacgtctatacggagatcaagtgcaactccctgctcccgctggatgacattgtc
cgcgtggtgacccacgaggactgcatccccgaggttaaaattgcgtacattaacttcctg
aatcactgctatgtggatacagaggtggaaatgaaggagatttataccagtaatcacatg
tggaaattgtttgagaatttccttgtggacatctgcagggcctgtaacaacacaagtgac
aggaaacacgcagactcagttttggagaggtacgtcaccgagattgtcatgagcatcgtt
accacattcttcagctctcccttctcagaccagagtacgactttgcagactcgccagccc
gtctttgtgcagctgctgcaaggtgtgttcagggtttaccactgcaactggctcatgccg
agccagaaggcctcggtggagagctgcattcgggtgctctctgatgtagccaagagccgg
gccatagccatccctgtggacctggacagccaggtcaacaacctcttcctcaagtcccac
aacatcgtgcagaaaactgccatgaactggcggctgacggcccgcaatgcagctcgcaga
gactctgtcctggcagcttccagagactaccggaatatcatcgagcgattgcaggacatc
gtctctgccctggaggaccgtctcaggcccctggtgcaggccgagttatctgtgctggtg
gacgtcctccacaggcctgagctgcttttcccggagaacacagatgccagaagaaagtgt
gaaagtggtggcttcatttgcaagttaataaagcacactaaacagctgctagaggagaat
gaggagaaactctgcattaaggtcctacagaccctcagagaaatgatgaccaaagatagg
ggctatggagaaaagctgatttccattgatgaattggataatgcagagctgccccaagct
ccggcttctgagaactccaccgaggaggttgaaccgagtccacccctgaggcaactggag
gaccataaaaggggtgaggccctcaggcagattttggtcaaccgttactatggaaacatc
agaccttcaggaagaagagagagccttaccagctttggcaatggcccgctgtcaccagga
ggacccggcaagcccgggggaggagggggaggttccgggtccagctccatgagcaggggg
gagatgagcctggctgaggttcagtgccatcttgacaaggagggggcctccaatctggtc
atcgacctcataatgaacgcatccagcgatcgagtgttccatgaaagcatcctcctggcc
atcgccctgctggaaggaggcaacaccaccatccagcactcctttttctgccggttgaca
gaagataagaagtcggaaaaattcttcaaggtcttctatgaccgaatgaaggtggcccag
caagaaatcaaggcaacggtgacagtgaacaccagtgacttgggaaataaaaagaaagat
gatgaggtagacagggatgccccatcacggaaaaaagccaaagagcccgcgacacagata
acggaagaggtccgggatcagctcctggaggcctctgccgccaccaagaaagccttcacc
accttcagaagggaggccgaccccgacgatcactaccagtcaggggagggcgcccaggcc
acagcagacaagaccaaggatgacctggagatgagcgcagtcatcaccatcatgcagccc
atcctccgattcctgcagtgcctttgttcccccaacctggggactgcccaattgcagaac
ttcctccgttgccaaaataacaagaccaactacaatttggtatgtgagacgctgcagttt
ctggactgtatttgtggaagtaccacggggggtctcggtcttctcgggctctatatcaac
gaaaagaacgtggccctcatcaaccaaaccctggaaagtctgaccgaatactgtcaagga
ccttgccacgagaaccagaactgcattgccacccatgaatccaatggcattgacatcatc
acggccctgatcctcaatgacatcaaccctctgggaaagaagaggatggacctcgtatta
gaactgaagaacaatgcatccaagctgctcctggccatcatggagagcaggcacgacagt
gaaaatgccgagaggatactctataacatgaggcccaaggaactggtggaagtgatcaag
aaagcctacatgcaaggcgacgtggaattcgaggatggagagaatggcgaggacggagct
gcttcccccaggaacgtgggacacaacatctacatcttagctcatcagttggctcggcac
aacaaagaacttcagaccatgctgaaacctggtggccaggtggagggagacgaagctctg
gagttttacgccaagcacacggcgcagatagagattgtcagattagaccgaaccatggaa
cagattgttttccccgtgcccagtatatgtgaattcctaaccaaggagtcaaagctacga
atatactacactacagagcgggatgagcaaggcagcaagatcaacgatttcttcctgcgg
tccgaggacctcttcaatgagatgaattggcagaagaagctgcgagcccagcccgttctg
tattggtgtgcccgcaacatgtctttctggagcagcatttcattcaacctggctgtcctg
atgaatctgcttgtggcctttttctacccatttaaaggagtccgaggaggaaccctggag
ccacactggtcagggctgctgtggacagccatgctcatatctctggccattgtcattgcc
ctccccaagccccacggcatccgagccttaatcgcgtccacaattctccggttgatattt
tcggttgggttacaacccacgttgtttcttctgggagctttcaacgtctgcaataaaatc
atctttctgatgagctttgtgggcaactgtgggacattcaccagaggctaccgagccatg
gtcctggatgttgagttcctttatcatttgctgtatctgctgatctgcgccctggggctc
ttcgtccatgaattcttctacagtttgctgctttttgacttagtgtacagagaagagact
ctgcttaatgtcattaaaagcgtcactcgcaacggacggtccatcatcttgacggcggtc
ctggctttgatcctggtttacctgttctcaatagtgggctaccttttcttcaaggatgac
ttcatcttggaagtagataggctgcccaatgaaacctctcttccagaagccagtgagagt
ttggcaagcgagttcctgtactctgacgtgtgtagggtggagactggggagaactgctcc
tctccggcacccaaagaagagcgggtccctgcagaagagacggagcaagataaagagcac
acgtgtgagacgctgctgatgtgcatcgtcacagtgctgagtcacgggctgcggagcggg
ggcggagtgggagatgtgctcaggaagccgtccaaagaggagcccctctttgctgctcga
gtgatctatgacctcttgttcttcttcatggtcatcatcattgtccttaatctgattttc
ggggtcatcattgacacctttgccgatctgaggagcgaaaagcagaagaaggaggagatc
ctaaagaccacgtgctttatctgcggcttggaaagggacaagttcgacaacaagactgtc
acctttgaagagcacatcaaggaggagcacaacatgtggcactacctgtgcttcatcgtc
ctggtgaaagtcaaggactccacagagtacacggggcccgagagttacgtggcggaaatg
atcaaggaaagaaaccttgactggttcccaaggatgagagccatgtccctggtcagcagc
gattcggaaggagaacagaatgagctgaggagcctgcaggagaagctggagtccaccatg
aagctggtcactaatctttctgggcagctgtcagaattaaaggaccagatgacagaacaa
aggaagcagaaacaaagaattggtcttctaggacatcctcctcacatgaacgtcaaccca
cagcaaccagcataa

DBGET integrated database retrieval system