KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070451
Entry
103070451         CDS       T03090                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103070451 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103070451 (ADCY9)
   04371 Apelin signaling pathway
    103070451 (ADCY9)
   04020 Calcium signaling pathway
    103070451 (ADCY9)
   04072 Phospholipase D signaling pathway
    103070451 (ADCY9)
   04024 cAMP signaling pathway
    103070451 (ADCY9)
   04022 cGMP-PKG signaling pathway
    103070451 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103070451 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103070451 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103070451 (ADCY9)
   04062 Chemokine signaling pathway
    103070451 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    103070451 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    103070451 (ADCY9)
   04912 GnRH signaling pathway
    103070451 (ADCY9)
   04913 Ovarian steroidogenesis
    103070451 (ADCY9)
   04915 Estrogen signaling pathway
    103070451 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    103070451 (ADCY9)
   04921 Oxytocin signaling pathway
    103070451 (ADCY9)
   04926 Relaxin signaling pathway
    103070451 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    103070451 (ADCY9)
   04918 Thyroid hormone synthesis
    103070451 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    103070451 (ADCY9)
   04916 Melanogenesis
    103070451 (ADCY9)
   04925 Aldosterone synthesis and secretion
    103070451 (ADCY9)
   04927 Cortisol synthesis and secretion
    103070451 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103070451 (ADCY9)
   04270 Vascular smooth muscle contraction
    103070451 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    103070451 (ADCY9)
   04971 Gastric acid secretion
    103070451 (ADCY9)
   04972 Pancreatic secretion
    103070451 (ADCY9)
   04976 Bile secretion
    103070451 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103070451 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103070451 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    103070451 (ADCY9)
   04727 GABAergic synapse
    103070451 (ADCY9)
   04725 Cholinergic synapse
    103070451 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    103070451 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103070451 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    103070451 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    103070451 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103070451 (ADCY9)
   04714 Thermogenesis
    103070451 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103070451 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    103070451 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103070451 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103070451 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103070451 (ADCY9)
   05163 Human cytomegalovirus infection
    103070451 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103070451 (ADCY9)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103070451 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 AC_N
Other DBs
NCBI-GeneID: 103070451
NCBI-ProteinID: XP_007453542
UniProt: A0A340X0V2
LinkDB
Position
Un
AA seq 1353 aa
MASPPHQQLLQHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRMGAGGRLRRKKKLPQLFERASSRWWDPKFDSMNLEEACMERCFPQTQRRFRYAL
FYIGFACLLWSIYFGVHMRSKLTVMVAPALCFLVVCVGIFLFTFTKLYARHYVWTSLVLT
LLVFALTLASQFQVLTPFSGRVDSFNHTRAARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLILGVAYSVLFETFGYHFQDKACFPSPEAEALHWELLSRALLHVCIHAIGIHLFI
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIRAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVTERLGQNVVADQLKGLKTYLIAGQRAKESHCSCSEALLSGFEVIDGSRVS
SGPRGQGTASPGSVSDLAQTVKTFDNLKTCPSCRIMFAPKLEAGAEGGAVQNGCQEEPKK
STKASGGPSSKTQNGLLSPPPEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQELEQAYRTSYQEEVIKNSPVKTF
ASATFSSLLDVFLSTTVFLILSITCFLKYGAASMPPPPAALVVFGAALLLEVLSLVVSVR
MVFFLEDVMACTKRLLEWIAGWLPRHFIGAILVSLPALAVYSHVTSEFETNIHSTVFTGS
AVLITVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSIVISHLDAVQNFSSER
NPCNASLPHDSRSPASLIGQEVILVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDNGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNATQCRDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDNGMVPQHQLSISP
DIRVQVDGSIGRSPTDEITNLVPSVQNPDQVSLGSENNTQARDTHPSSKKPWKEPIKAEE
RCRFSKAIEKSDCEEAGEEEANELTKLNVSKRA
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctgctgcagcaccacagcaccgaggtgagttgtgac
tccagcggagacagcaacagcgtgagggtcaaaatcaaccccaagcagctgtcctccaac
agccacccgaaacactgcaagtacagcatctcctccagctgtagcagctccggggactca
gggggcgtcccccggagaatgggcgccggaggccgcctgcgcaggaaaaagaagctgcct
cagctgttcgagagggcctccagccggtggtgggaccccaaattcgactccatgaacctg
gaggaggcttgcatggagcgctgcttcccgcagacccagcgccgcttccggtatgcgctc
ttctacattggcttcgcctgccttctctggagcatctattttggggtccacatgagatcc
aaactgactgtcatggtagcccctgctctgtgcttcctcgtggtgtgtgtgggcattttt
ctgtttaccttcaccaagctgtacgcccggcattacgtgtggacctcgctggttcttacc
ctcctggtgttcgccctgactctggcttcccagtttcaggttttgacgcccttctcagga
cgagttgacagcttcaatcatactcgggcagccaggcccacagacacttgcttatctcaa
gtggggagcttttccatgtgcattgaagtgctctttttgctctacaccgtcatgcactta
cctttgtacttgagcttgattttgggagtggcctattctgttctttttgagacctttggc
tatcatttccaagacaaagcctgcttcccctcacctgaagcagaggccctgcactgggag
ctgctgagccgagccctgctccacgtctgcattcacgccattgggatccacctgttcatc
atgtcccaggtgagatccaggagcaccttcctcaaggtgggccagtcaattatgcatgga
aaggatctggaagtggaaaaagccctgaaagagaggatgattcattctgtgatgccaaga
atcatagctgatgacttgatgaagcagggggacgaggagagcgagaattctgtcaaaagg
catgccacctccagccccaagaacaggaagaaaaagtcttccatacagaaagcccctatt
gccttccgcccgtttaaaatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaataagtccgcccatgccctggtggggctcctcaac
gatctgttcggccgcttcgaccggttgtgcgaggagaccaagtgtgagaaaatcagcact
ctgggagactgctactactgtgtggccgggtgtcccgagcctcgggccgaccatgcctac
tgctgcatcgaaatgggcttgggcatgataagggctatcgagcagttctgccaagagaag
aaagagatggtgaacatgcgtgttggggttcacacggggactgtcttgtgcggcatcttg
ggcatgaggaggtttaaattcgatgtgtggtccaatgatgtgaacttggccaatctcatg
gagcagctgggagtggctggcaaggttcacatttccgaggccaccgcaaaatacctagat
gaccggtacgaaatggaagatgggaaggtaactgaacgcctcggccagaacgttgttgct
gaccagttgaaaggtttgaagacatacctgatagcgggtcagagagcgaaggagtctcat
tgcagctgttcagaggccttgctttctggctttgaggtcattgacggctcacgggtgtcc
tcaggccctaggggacaggggacagcatcgccagggagtgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccatcgtgcagaatcatgtttgctcccaaa
ttggaagctggcgctgaaggcggagcagtccagaatggctgtcaggaggagcccaagaag
agcaccaaggcttctggaggacccagttccaaaacgcaaaacggactgctgagccctccc
ccggaggagaagctcaccaacagtcagacctccctgtgcgagatcttacaagagaaggga
aggtgggcaggtgtgagcttggaccagtcagccctccttccgctgaggttcaagaacatc
cgggagaaaacggatgcccattttgttgatgttatcaaggaagacagcctgatgaaagat
tatttttttaagccacccattaatcagttcagcttgaacttcctggatcaggagctagaa
caagcctacaggaccagctatcaagaagaggttataaagaattctcccgtgaagactttt
gccagtgccaccttcagctccctcctggatgtgtttctgtcgacaacagtgtttctgatt
ctctccattacctgcttcctgaagtatggggctgcctccatgccacccccgccggccgcc
ctggtggtcttcggagcagccctgcttctggaggtcctgtccctcgtggtctccgtcagg
atggtgttcttcctggaggatgtgatggcttgtaccaagcgcctgctggagtggatagcc
ggctggctcccgcgccatttcatcggggccatcctggtgtccctccccgccctcgcggtc
tattcacatgtcacctccgaatttgagacaaacatacactccaccgtgttcacgggctcg
gctgtcctgatcaccgtggtgcactactgtaacttctgccagctcagctcctggatgagg
tcctccttggccacagtcgtcggggccgggcccctgctgctgctctacgtctccctctgc
ccagacagttccatagtaatttcgcacctggatgcagtacagaatttcagctccgagagg
aatccgtgcaacgcctcgctgccgcacgacagcaggagcccagccagcctaatcggccag
gaggtgattcttgtcttcttcctcctgctcttgttggtctggttcctgaatcgagaattc
gaagtcagctaccgcctacactaccacggggacgtggaggcggacctgcaccgcactaag
atccagagcatgagggaccaggccgactggctgctgagaaacatcatcccctaccacgtg
gccgagcagctgaaggtctcccagacctactccaagaaccacgacaacggaggagtcatc
tttgccagcatcgtcaacttcagcgagttctatgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctgatcggggacttcgacgagctcctgagcaagccggac
tacagcagcatcgagaagatcaagaccatcggggccacatacatggccgcgtctgggctg
aatgccacacagtgccgtgacggcagccacccgcaggagcacctgcagatcctgtttgag
tttgccaaggagatgatgcgtgtggtggacgacttcaacaataacatgctctggttcaac
ttcaagctcagggtgggcttcaaccatgggccgctgacggcaggcgtcattggcaccacc
aagctgctgtacgacatctggggagacacggtcaacatcgccagcaggatggacaccacg
ggggtggagtgccgcatccaggtcagcgaggaaagctaccgcgtcctgagcaagatgggc
tacgacttcgactacagagggacggtgaacgtcaagggcaaaggccagatgaagacctac
ctgtaccccaagtgcacggacaacgggatggtgccgcagcaccagctctccatctcccct
gacatccgagtccaggtggacggcagcatcggacgctcccccacggacgagatcaccaac
ctggtgccttccgtacagaacccggaccaggtgtccctgggctccgagaacaacacacag
gccagggacactcacccgtcttctaagaaaccctggaaggagcccatcaaagccgaagaa
aggtgtaggttcagcaaagccatagagaaaagcgactgtgaagaagcaggggaggaggaa
gccaatgaactcaccaagctcaacgtctcaaagagggcgtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075153
Entry
103075153         CDS       T03090                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103075153 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103075153 (ADCY6)
   04371 Apelin signaling pathway
    103075153 (ADCY6)
   04072 Phospholipase D signaling pathway
    103075153 (ADCY6)
   04024 cAMP signaling pathway
    103075153 (ADCY6)
   04022 cGMP-PKG signaling pathway
    103075153 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103075153 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103075153 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103075153 (ADCY6)
   04062 Chemokine signaling pathway
    103075153 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    103075153 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    103075153 (ADCY6)
   04912 GnRH signaling pathway
    103075153 (ADCY6)
   04913 Ovarian steroidogenesis
    103075153 (ADCY6)
   04915 Estrogen signaling pathway
    103075153 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    103075153 (ADCY6)
   04921 Oxytocin signaling pathway
    103075153 (ADCY6)
   04926 Relaxin signaling pathway
    103075153 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    103075153 (ADCY6)
   04918 Thyroid hormone synthesis
    103075153 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    103075153 (ADCY6)
   04916 Melanogenesis
    103075153 (ADCY6)
   04924 Renin secretion
    103075153 (ADCY6)
   04925 Aldosterone synthesis and secretion
    103075153 (ADCY6)
   04927 Cortisol synthesis and secretion
    103075153 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103075153 (ADCY6)
   04270 Vascular smooth muscle contraction
    103075153 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    103075153 (ADCY6)
   04971 Gastric acid secretion
    103075153 (ADCY6)
   04972 Pancreatic secretion
    103075153 (ADCY6)
   04976 Bile secretion
    103075153 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103075153 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103075153 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    103075153 (ADCY6)
   04727 GABAergic synapse
    103075153 (ADCY6)
   04725 Cholinergic synapse
    103075153 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    103075153 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    103075153 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    103075153 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    103075153 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    103075153 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103075153 (ADCY6)
   04714 Thermogenesis
    103075153 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103075153 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    103075153 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103075153 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103075153 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103075153 (ADCY6)
   05163 Human cytomegalovirus infection
    103075153 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103075153 (ADCY6)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103075153 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103075153
NCBI-ProteinID: XP_007452296
UniProt: A0A340WTP8
LinkDB
Position
Un
AA seq 1166 aa
MSWFSGLLVPKVDERKTAWGERNGQKRPRRGTRSSGFCTPRYMSCFQGAQPPSPTPAAAP
RCPWQDEAFIRRGGPGKGLELGLRAVALGFEDPEATVAVGAAEGAPDAAARSRRACWRRL
VQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLMAVLLAFHAAPAHPQPAYVA
LLACAAVLFVALMVVCNRHSFRQDSMWLVSYVVLGILAAVQVGGALTASPRSPSVGLWCP
VFFVYITYTLLPIRMRAAVFSGLGLSTLHLILAWQLNRGDAFLWKQLGANMLLFLCTNVI
GICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINTKK
EDMMFHRIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLR
IKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHC
GVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYL
KEQHIETFLILGASQKRKEEKAMLAKLQRARANSMEGLMPRWVPDRTFSRTKDSKAFRQM
GIDDSSKDNRGAQDALNPEDEVDEFLGRAIDARSIDQLRKDHVRRFLLTFQREDLEKKYS
RKVDPRFGAYVACALLVFCFICFIQLLVFPPSALMLGIYASIFLLLLVTVLTCAVYSCGS
LFPQALRRLSRSIVRSRAHSTAVGIFSVLLVFISAIANMFTCNHTPIRTCAAQMLNLTPA
DITACHLQQLNYSLGLDAPLCEGTAPTCSFPEYFVGSMLLSLLASSVFLHISSIGKLAMI
FVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFSGLDCSAAGRVALKYMTPVIL
LVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLA
RERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEE
RFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQ
MKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQ
LECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccccaaagtggatgaacggaaaacagcctggggc
gagcgcaatgggcagaagcgtccacgccgcgggactcgctccagtggcttctgcacaccc
cgttatatgagctgctttcagggtgcacagccacccagcccgacccccgcagccgcgcct
cggtgcccctggcaggatgaggccttcatccggaggggtggcccaggcaagggcctggag
ctggggctgcgggctgtggccctgggcttcgaggaccctgaggcgaccgtggcagtcggg
gccgctgagggggcccccgatgcagccgccaggagcaggcgagcttgctggcgccggctg
gtgcaggtgttccagtcaaagcagttccgctcggccaagctggagcgcttgtaccagagg
tactttttccagatgaaccagagcagcctgacgctgctgatggccgtgctggtgctgctc
atggccgtgctgctggccttccacgcggcgcctgcccaccctcagcctgcctacgtggcc
ctgctggcctgcgccgccgtcctcttcgtggcgctcatggtggtgtgcaatcgacacagc
ttccgccaggactccatgtggctggtgagctacgtggtgctgggcatcctggcagccgtg
caggtcggcggcgccctgacagccagcccccgcagcccttctgtaggcctctggtgcccc
gtgttcttcgtctacatcacctacacgcttctccccatccgcatgcgggctgctgtcttc
agtggcctgggcctctccaccctgcacttgatcttggcctggcaactcaaccgtggtgat
gccttcctctggaagcagctcggtgccaacatgctgctgttcctctgcaccaatgtcatt
ggcatctgcacacactacccagctgaggtgtctcagcgccaggcctttcaggagacccgt
ggttacatccaggcccggctgcacctgcagcatgagaatcggcagcaggagcggctgctg
ctgtccgtgttgccccagcatgttgccatggagatgaaagaagacatcaacacaaagaaa
gaagacatgatgtttcacaggatctacatccagaagcatgacaatgtcagcatcctgttt
gcggacattgaaggcttcaccagcctggcatcccagtgcacggcgcaggagctggtcatg
accctgaacgagctctttgctcggtttgacaagctggctgcggaaaatcactgcctgagg
atcaagatcttaggggactgttactattgtgtgtcagggctgccagaggcccgggcagac
catgcccactgctgcgtggagatgggggtggacatgatcgaggccatctcgctggtgcgc
gaggtgacaggtgtgaacgtgaacatgcgcgtgggcatccacagcgggcgcgtgcactgc
ggcgtccttggcctgcggaaatggcagttcgatgtgtggtccaatgacgtgactctggcc
aatcacatggaggccgggggccgggccggccgcatccacatcactcgggccacgctgcag
tacctgaacggggactacgaggtggagccgggccgtggcggggagcgcaacgcctacctc
aaggagcagcacattgagacgttcctcatcctgggagccagccagaaacggaaagaggag
aaggccatgctggccaagctgcagcgggcgcgggccaactccatggaggggctgatgcca
cgctgggtgcccgaccgcaccttctcccggaccaaggactcgaaggctttccggcagatg
ggcattgatgattccagcaaggacaaccggggtgcccaggatgccctgaaccctgaggat
gaggtagacgagttcctgggccgtgccatcgatgcccgcagcatcgatcagctgcgcaag
gaccacgtgcgccggttcctgctcaccttccagagagaggatcttgaaaagaagtactcg
cgaaaggtggacccccgcttcggagcctacgtggcctgtgccctgttggtcttctgcttc
atctgcttcatccagctcctcgtcttcccaccctcagccctgatgcttgggatctatgcc
agtatcttcctgctgttgctggtcaccgtgctgacctgcgccgtgtactcgtgtggctct
ctgttccctcaggccctgcgacgtctgtctcgcagcatcgtccgctcgcgggcacatagc
actgcggttggcatcttttccgtcctgcttgtgttcatctctgccatcgccaacatgttc
acctgtaaccacacccccatacggacttgcgcagcccagatgctgaatttaacacctgct
gacatcactgcctgccacctgcagcagctcaattactcactgggcctggatgctcccctg
tgtgagggcaccgcccccacttgcagcttccctgagtacttcgtcgggagcatgctgctg
agtctcttggccagctctgtcttcctgcacatcagtagcatcgggaagttggccatgatc
tttgtcctggggctcatctatttggtgctgcttctgctggggcccccggccaccatcttt
gacaactacgacctactgcttggcgtccatggcttggcttcttccaacgagaccttcagt
gggctggactgctcagccgcagggagggtggcactcaaatatatgacccctgtgattctg
ctggtgtttgcactggcgctgtatctgcatgcccagcaggtggaatcaactgcccgcctg
gacttcctctggaaactgcaggccacaggggagaaggaggagatggaggagctccaggca
tacaaccggcggctgctacataacattctgcccaaggacgtggccgcccacttccttgcc
cgggagcgccggaatgatgagctctactatcagtcatgtgagtgcgtggccgtcatgttt
gcctccattgccaacttctctgagttctacgtggagctagaggcaaacaatgagggtgtc
gagtgcctgcggctgctcaacgagatcatcgctgacttcgatgagatcatcagcgaggag
cggttccggcagctggagaagatcaagacgattggtagcacctacatggctgcctctggg
ctgaatgccagcacctatgatcaggtgggccgctcccacatcactgcccttgccgactac
gccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaatttccag
atgaagatcgggctgaacatgggcccagttgtggcaggcgtcattggggctcggaagccg
cagtatgacatctgggggaacacagtgaatgtctctagccgcatggacagcacgggggtc
cccgaccgaatccaggtgaccacggacctgtaccaggttctagcggccaagggctaccag
ctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctacttcctc
aatgggggccccagcagttag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075499
Entry
103075499         CDS       T03090                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103075499 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103075499 (ADCY4)
   04371 Apelin signaling pathway
    103075499 (ADCY4)
   04020 Calcium signaling pathway
    103075499 (ADCY4)
   04072 Phospholipase D signaling pathway
    103075499 (ADCY4)
   04024 cAMP signaling pathway
    103075499 (ADCY4)
   04022 cGMP-PKG signaling pathway
    103075499 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103075499 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103075499 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103075499 (ADCY4)
   04062 Chemokine signaling pathway
    103075499 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    103075499 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    103075499 (ADCY4)
   04912 GnRH signaling pathway
    103075499 (ADCY4)
   04913 Ovarian steroidogenesis
    103075499 (ADCY4)
   04915 Estrogen signaling pathway
    103075499 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    103075499 (ADCY4)
   04921 Oxytocin signaling pathway
    103075499 (ADCY4)
   04926 Relaxin signaling pathway
    103075499 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    103075499 (ADCY4)
   04918 Thyroid hormone synthesis
    103075499 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    103075499 (ADCY4)
   04916 Melanogenesis
    103075499 (ADCY4)
   04925 Aldosterone synthesis and secretion
    103075499 (ADCY4)
   04927 Cortisol synthesis and secretion
    103075499 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103075499 (ADCY4)
   04270 Vascular smooth muscle contraction
    103075499 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    103075499 (ADCY4)
   04971 Gastric acid secretion
    103075499 (ADCY4)
   04972 Pancreatic secretion
    103075499 (ADCY4)
   04976 Bile secretion
    103075499 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103075499 (ADCY4)
   04727 GABAergic synapse
    103075499 (ADCY4)
   04725 Cholinergic synapse
    103075499 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    103075499 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    103075499 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    103075499 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    103075499 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    103075499 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103075499 (ADCY4)
   04714 Thermogenesis
    103075499 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103075499 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    103075499 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103075499 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103075499 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103075499 (ADCY4)
   05163 Human cytomegalovirus infection
    103075499 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103075499 (ADCY4)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103075499 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 103075499
NCBI-ProteinID: XP_007447961
UniProt: A0A340WGY9
LinkDB
Position
Un
AA seq 1073 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLVIVLVGLLALLAVAWELASDPGFLTT
MLCGLGGFSLLLGLASREQRLQRWTRPLSGLVWAALLALGLGFLFTGGVVSAWDQVSFFL
FVIFTVYAMLPLGMRDAAAAGLASSLSHLLVLGLYLGPQPDSQPALLPQLAANAVLFLCG
NVAGAYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIM
ARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNELFGK
FDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATGVDIN
MRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEASGVPGRVHITGATLALLAGAYAV
EDAAMEHGDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGPKMRPSLLMTRYLES
WGAAKPFAHLSHVESPVSTSTPLPEKALSSFSPQWSLDRSRTPRGLDDELDTGDAKFFQV
IEQLNSQKQWKQSEDFNPLTLYFREKEMEKEYRLSALPAFKYYAACTFLVFFSNFIIQML
VTNRPPALTITYSITFLLFFLLLFVCFSEHLTKCVLKGPKMLHWLPTLSVLVATRPGLRV
ALGTATILLVFSMAITSLVFLPAASNCPFLAPNVSSTASNLSWELPGSLPLISVPYSVHC
CVLGFLSCSLFLHTSFELKLLLLLLWLAACCSLFLHSHAWLSDCLIARLYLGALDSRPGL
LKEPKLMGAISFFVFFFTLLVLARQNEYYCRLDFLWKKKLRQEQEETETMENLTRLLLEN
VLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESSINHEGLECLRLLNE
IIADFDELLSKPKFSGVEKIKTICSTYMAATGLNATSGQDAQQDAEQSCSHLGTMVEFAV
ALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLG
KIQVTQETACALQSLGYTCYSRGIIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3222 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagtccccggccgcctcccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccactgctgctactgcttctggtgatcgtgctcgtcggg
ctcctggcgctgctcgctgttgcctgggagctggcctcagacccgggcttcctgaccact
atgctgtgcgggctgggcggcttctcgctgctgctgggcctggcttcccgcgagcagcga
ctgcagcgctggacgcgtcccctgtcgggcctcgtgtgggcagcgctgctcgcgctgggc
ctcggcttcctcttcactgggggcgtggtgagcgcctgggaccaggtgtcctttttcctt
tttgtcatcttcaccgtgtatgccatgttgcccttgggcatgcgggacgccgccgccgcg
ggtctcgcctcttcactctcacacctgctggtcctcgggctgtatcttgggcctcagccg
gactcacagcccgcgctcctgccacagctggcggcaaacgccgtgttgttcctgtgcggg
aacgtggctggagcataccacaaggcgctgatggagcgcgcgctgcgcgccacgttccgg
gaggcgcttagttccctgcactcccgccggaggctcgacacagagaagaagcaccaggaa
caccttctcttgtccatccttcctgcctacctggcccgagagatgaaggcggagatcatg
gcacggctgcaggccggacaggggtcacggccagagagcaccaacaacttccacagcctc
tatgtcaagaggcaccagggagtgagcgtgctgtatgctgacatcgtgggcttcacgcgg
ctggccagtgagtgctcccctaaggagttggtgctcatgctaaacgagctctttggcaag
ttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctgggagactgttac
tactgtgtctccgggctgccgctctcgctgccagaccatgccatcaactgcgtgcgcatg
gggctggacatgtgccgggccatcaggaagcttcgggcagccaccggcgtggatatcaac
atgcgtgtgggtgtgcactcgggcagcgtgctctgcggggtcatcgggctgcagaagtgg
cagtatgatgtctggtcccatgacgtcactctggccaaccacatggaggcgagtggagtg
ccaggacgagtacatatcacaggggctacgctggcactgctggcaggggcttacgctgtg
gaggatgcagccatggaacacggggacccatacctccgggagctaggggagccgacctac
cttgtcatcgatccccgggctgaggaggaggacgagaagggcactgcaggcgggttgctg
tcctctcttgagggccccaagatgcgtccatcactgttgatgacccgctacctggagtcc
tggggtgcagccaagcctttcgcccacctgagccatgtggagagccctgtgtccacctcc
acccctctcccggagaaggccctgtcttccttcagcccccagtggagcctggaccggagc
cgtaccccccggggactagatgatgaactagacaccggggatgccaagttcttccaagtc
atcgaacagctcaactctcagaaacagtggaaacagtcagaggacttcaacccattgacc
ctgtacttccgggagaaggagatggagaaagagtatcggctctctgcactccccgccttc
aaatactatgcagcctgcaccttcctggtttttttctccaacttcatcatccagatgctg
gtgacaaacaggcccccagctctgaccatcacctatagcatcaccttcctcctcttcttc
ctcctcctcttcgtctgcttctcagagcacctgacgaagtgtgtcttgaaaggccccaag
atgctgcactggctgcccacactgtctgtcctagtggccacacggcccggactgcgagtt
gccctgggcaccgctaccatcctgctcgtcttctccatggccattaccagcctggtcttc
ttaccggcagcatcaaactgccctttcctggctcccaatgtgtcctccacagcttccaac
ctctcctgggagctccctgggtccctgcctctcatcagcgtcccctactccgtgcactgc
tgcgtgctggggttcctctcctgctccctcttcctgcacacgagcttcgagctgaagctg
ctgctgctgctgctgtggctggcagcctgctgctccctcttcctgcactcccacgcctgg
ctgtccgactgtctcatcgcccgcctctatctgggcgccttggactccaggccagggctg
ctgaaggagcctaaactgatgggagcaatctccttctttgtcttcttcttcaccctcctg
gtcctggctcggcagaatgagtattactgccgcctggacttcctgtggaagaagaagctg
aggcaagagcaggaggagacagagacgatggaaaacctgactcggctgctcctggagaat
gtgctccccgcgcacgtagccccccagttcatcggccagaatcggcgcaacgaggacctc
taccaccagtcctacgagtgtgtttgtgtcctcttcgcctcagtcccagacttcaaggag
ttttactctgaatccagcatcaaccacgaggggctagagtgtctgcggctgctcaatgag
ataattgctgattttgatgagctgctctccaagcccaagttcagtggggtggagaaaatc
aaaactatctgcagcacctacatggcggctacaggcttgaacgccacctccggacaggac
gcacagcaggatgctgagcaaagctgcagccaccttggcaccatggtagagtttgccgtg
gcccttgggtctaagctggacgtcatcaacaagcactcattcaacaacttccgcttgcgt
gtggggttaaaccacggacctgtagtggccggagtgattggggcccagaaaccacaatat
gacatctggggcaacacggtgaacgtggccagccgaatggagagtacaggcgtcctgggc
aagatccaagtgacccaagagacagcctgcgccctgcagtccttaggctacacctgctac
agccggggcatcatcaaggtcaaaggcaaagggcagctctgcacctacttcctgaacaca
gatttgacacgaactggacctccctcggccaccctaggctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076182
Entry
103076182         CDS       T03090                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103076182 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103076182 (ADCY3)
   04371 Apelin signaling pathway
    103076182 (ADCY3)
   04020 Calcium signaling pathway
    103076182 (ADCY3)
   04072 Phospholipase D signaling pathway
    103076182 (ADCY3)
   04024 cAMP signaling pathway
    103076182 (ADCY3)
   04022 cGMP-PKG signaling pathway
    103076182 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103076182 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103076182 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103076182 (ADCY3)
   04062 Chemokine signaling pathway
    103076182 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    103076182 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    103076182 (ADCY3)
   04912 GnRH signaling pathway
    103076182 (ADCY3)
   04913 Ovarian steroidogenesis
    103076182 (ADCY3)
   04915 Estrogen signaling pathway
    103076182 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    103076182 (ADCY3)
   04921 Oxytocin signaling pathway
    103076182 (ADCY3)
   04926 Relaxin signaling pathway
    103076182 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    103076182 (ADCY3)
   04918 Thyroid hormone synthesis
    103076182 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    103076182 (ADCY3)
   04916 Melanogenesis
    103076182 (ADCY3)
   04925 Aldosterone synthesis and secretion
    103076182 (ADCY3)
   04927 Cortisol synthesis and secretion
    103076182 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103076182 (ADCY3)
   04270 Vascular smooth muscle contraction
    103076182 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    103076182 (ADCY3)
   04971 Gastric acid secretion
    103076182 (ADCY3)
   04972 Pancreatic secretion
    103076182 (ADCY3)
   04976 Bile secretion
    103076182 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103076182 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103076182 (ADCY3)
   04727 GABAergic synapse
    103076182 (ADCY3)
   04725 Cholinergic synapse
    103076182 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    103076182 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    103076182 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    103076182 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    103076182 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    103076182 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103076182 (ADCY3)
   04714 Thermogenesis
    103076182 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103076182 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    103076182 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103076182 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103076182 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103076182 (ADCY3)
   05163 Human cytomegalovirus infection
    103076182 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103076182 (ADCY3)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103076182 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 103076182
NCBI-ProteinID: XP_007455568
UniProt: A0A340X1W5
LinkDB
Position
Un
AA seq 1141 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRRVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFVLCRKGLLPTRVTRKVVPYLLWLLITAQVFCLGLNFSRAHAASDTVGWQAFFVFSFFI
TLPLSLSPIVVISVVSCIVHTLVLGVTVAQQQRDGLKGMQLLREILANVFLYLCAIVVGI
MSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDESQ
KDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQL
RIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTVL
GGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDY
LDEKGIETYLIIATKPEVKRTAAQNGLSGSALLNGVPPSSKPGSPALIETKEPNGSIHTS
GSTSEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVR
KRNTFFLSMRFTDREMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTF
VVGEVLLLTLTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTWAMLAIFILVMANVVDM
LSCLQYYMGPTNGTSGVQIEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLIA
GAVAVINIYAWRPIFDEYDRRRFQEHDFPMVALEKMQVPSSPGLNGTDRLPLVPSRCSMT
GMIFVMTLGFYYFCRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARH
FLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLL
DNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKVERSDKERWQHLADLADFALAM
KDTLANINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNI
QVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQVVDN
S
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgaatactcggccgagtac
tccgtcagcctgccctctgaccctgaccgcagggtgggccggacccatgagatctctgtc
cgcaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaaaaggcagcgccacgagacgctgctggtg
ctggtggtattcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaagctggctcccctggctgtggccggggtcgggctggtgttggacatcatc
ctctttgtgctctgcagaaaggggctgctgcccacccgggtcacccggaaagtggtgccc
tacctgctgtggctgctgataacagcccaggtcttctgcctgggcctgaacttctcccgc
gcgcacgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttcatc
acgctgcccctcagcctcagccccatcgtcgtcatctctgtggtctcctgcatcgtgcac
acgcttgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggggatgcag
ttgctgagggagattctggccaatgtcttcctctatctgtgcgccatcgttgtgggcatc
atgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccagtcg
ctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctttcc
atcctgcccaagcacgtggcagacgagatgctgaaggacatgaaaaaggacgagagccag
aaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaatgtcagcatcctg
tttgccgacatcgtgggcttcacccagctgtcctcagcctgcagcgcccaagagctcgtg
aagctcctcaatgagctctttgcccgcttcgacaagctggcggccaaataccaccagctg
cggattaagattctgggcgactgttactactgcatctgtgggctgcctgactaccgcgag
gaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtatgta
cgggagaagacgaagaccggggtggacatgcgagtcggggtgcacacgggcaccgtgctg
gggggtgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgatgtcaccgtg
gccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcccagagcaccatg
gactgcctgaaaggcgagtttgacgtggagccaggtgatgggggcagccgctgtgattac
ctggatgagaagggcatcgaaacctacctcatcattgcgaccaagccagaggtgaagagg
acagctgcccaaaatggcctcagcggctcagctctgctgaacggagtgccaccttcctca
aagcccggctcccctgccctcattgagaccaaggagcctaacgggagcatccacaccagc
ggctccacgtccgaggagccagatgcccaggctgacaacccctcattccccaaccctcgc
cggaggctgcggcttcaggacctggccgatcgcgtggtggacgcctccgaggatgagcac
gagctcaaccagctgctcaacgaggccctgctggagcgggagtccgcccaggtggtgagg
aagagaaacaccttcttcctgtccatgcggttcacggaccgcgagatggaaacgcgctac
tcggtggagaaggagaagcagagcggggccgccttcagctgttcctgcgtcgtcctgctc
tgcaccgccctggttgagattctcatcgacccctggctgatgacaaactatgtgaccttt
gtggttggcgaggtcctgctcctgaccctgactgtctgctcgctggctgccatctttcct
cgggcctttcctaagaagatcgtggccttctcgacttggatcgaccggacgcgctgggcc
aggaacacctgggccatgctggccatcttcattctggtcatggcaaacgtcgtggacatg
cttagctgtctccagtactacatgggacccaccaacggcacctcaggggtgcagatagag
gacggctgcgtggagaaccccaagtattacaactacgtcgctgtgctgtccctcatcgcc
accatcatgctggtgcaggtcagccacatggtcaagctgacactcatgctgctcatcgca
ggggctgtggccgtcatcaacatctacgcctggcgccccatctttgatgaatacgaccgc
agacgcttccaagaacacgactttccgatggtggccttagagaagatgcaggtaccttcc
agccctgggctcaatggcactgacaggctgcccctggtgccgtccaggtgctcgatgaca
gggatgatcttcgtcatgacgctcggcttctactacttctgccgccacgtggagaagctg
gcacgaacactgttcttatggaagattgaggtccacgaccagaaggaacgtgtctatgaa
atgagacgctggaacgaggccttggtcactaacatgttgcctgagcacgtggcacgccat
ttcctggggtccaagaagagagacgaggagctgtacagtcagtcttatgacgagattgga
gtcatgtttgcctccctgcccaactttgccgacttctacacagaggagagcatcaataac
ggtggcattgagtgtctgcgcttcctcaatgagatcatctcagattttgactctctcctg
gacaatcccaagtttcgggtcatcaccaagatcaaaaccattggcagcacctacatggca
gcttcaggagtcaccccagatgtcaacaccaatggctttaccagctccaacaaggtagag
aggtcggacaaggagcgctggcagcacctggcagatctggccgacttcgcgctcgccatg
aaagacacgctcgccaacatcaacaaccagtccttcaataacttcatgttgcgcatcggc
atgaacaaaggaggggtactggctggcgtcatcggagcccggaaaccacactatgacatc
tggggcaatacagtcaacgttgccagcaggatggagtccacaggggtcatgggcaacatt
caggtggtggaagaaactcaagtcatccttcgagagtacggcttccgctttgtgaggaga
gggcccatctttgtgaaagggaagggggagctgctgacctttttcttgaaggggcgagag
aagccagccacgttccctaatggctcctcggttacactgccccaccaggtagtagacaac
tcctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078677
Entry
103078677         CDS       T03090                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase 7
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103078677 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103078677 (ADCY7)
   04371 Apelin signaling pathway
    103078677 (ADCY7)
   04020 Calcium signaling pathway
    103078677 (ADCY7)
   04072 Phospholipase D signaling pathway
    103078677 (ADCY7)
   04024 cAMP signaling pathway
    103078677 (ADCY7)
   04022 cGMP-PKG signaling pathway
    103078677 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103078677 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103078677 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103078677 (ADCY7)
   04062 Chemokine signaling pathway
    103078677 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    103078677 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    103078677 (ADCY7)
   04912 GnRH signaling pathway
    103078677 (ADCY7)
   04913 Ovarian steroidogenesis
    103078677 (ADCY7)
   04915 Estrogen signaling pathway
    103078677 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    103078677 (ADCY7)
   04921 Oxytocin signaling pathway
    103078677 (ADCY7)
   04926 Relaxin signaling pathway
    103078677 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    103078677 (ADCY7)
   04918 Thyroid hormone synthesis
    103078677 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    103078677 (ADCY7)
   04916 Melanogenesis
    103078677 (ADCY7)
   04925 Aldosterone synthesis and secretion
    103078677 (ADCY7)
   04927 Cortisol synthesis and secretion
    103078677 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103078677 (ADCY7)
   04270 Vascular smooth muscle contraction
    103078677 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    103078677 (ADCY7)
   04971 Gastric acid secretion
    103078677 (ADCY7)
   04972 Pancreatic secretion
    103078677 (ADCY7)
   04976 Bile secretion
    103078677 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    103078677 (ADCY7)
   04727 GABAergic synapse
    103078677 (ADCY7)
   04725 Cholinergic synapse
    103078677 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    103078677 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103078677 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    103078677 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    103078677 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103078677 (ADCY7)
   04714 Thermogenesis
    103078677 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103078677 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    103078677 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103078677 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103078677 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103078677 (ADCY7)
   05163 Human cytomegalovirus infection
    103078677 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103078677 (ADCY7)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103078677 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 103078677
NCBI-ProteinID: XP_007459540
UniProt: A0A340XKH5
LinkDB
Position
Un
AA seq 1078 aa
MPAKGRYFLNEGEEDPNHDTLYEKYRLTSQHGPLLLTLLLVAITACVVLIIIAFSYGDPS
RHQAVLGTAFFTLAVFVALYALVYVECLVRRWLRASALLIWACLVTLGYVLVFDSWMKEA
CDWEQVPFFLFVVFVVYTLLPFSTRGAVVAGVVSSTSHLLVLGALMGAFTTPSVRVGLQL
LANAVVFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKERGDRRYLPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPSHARNCVKMGLDMCEAIKQ
VREATGVDISMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LNHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSLHLTKSKGDATLKMRA
SVRMTRYLESWGAARPFAHLNQRENVSSNETPVPHGRRPKAIPLRRHRTPDRSASPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARYYFACA
GLVFICILLVHALLMPRMAALGVSFGLVACVLGLVLGLCFAHELLRCCPARGALRAISER
VETQPLLRVSLAVLTIGSLLAVAVVNLPLMPFPAPGLPAGNETGPGAVSSWERALCKLLP
YYTCSCILAFIACSVFLRMSLELKVVLLTVALVAYLVLFNISPCWQWDCCGHSLGNLTKT
NGTLSSPSCSWDLKTMINFYLVLFYTTLIMLSRQIDYYCRLDCLWKRKFKKEHEEFETME
NVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGL
ECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSIPSGHENQDLERQHAHIG
IMVEFSTALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRM
ESTGELGKIQVTEETCTILQGLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3237 nt   +upstreamnt  +downstreamnt
atgccggccaaggggcgttacttcctcaacgagggcgaggaggaccccaaccacgacacg
ctctacgagaagtaccgcctcaccagccagcatgggccgctgctactcacactcctgttg
gtggccatcactgcctgtgtcgtcctcatcatcatcgccttcagctacggggacccctcc
agacaccaggctgtcctggggacggcgttcttcacgcttgctgtgtttgtggctctctac
gcgctcgtgtatgttgagtgcctcgtccgccggtggctcagggcctcggcgctactcatc
tgggcctgccttgtgacgctgggctacgtgctggtgtttgactcatggatgaaggaggcc
tgtgactgggagcaggtgcccttcttcctgttcgtggtcttcgtggtgtacacgctgctg
cccttcagcacgcggggtgccgtcgtggccggggtcgtctccagcacctcccacctcctg
gtgctcggcgctctgatgggggccttcaccacgcccagcgtccgggtagggctgcagctg
ctggccaatgctgtggtcttcctgtgcgggaacctcacgggcgccttccacaagcaccag
atgcaggatgcctcccgagacctcttcacctacactgtgaagtgcatccagatccgtcgt
aaactgcgcatcgagaagcgccagcaggagaacctgctgctgtccgtgctgcctgcccac
atctccatgggcatgaagctggccatcatcgagcggctcaaggagcgcggggaccgccgc
tacctgcctgacaacaacttccatagcctctacgtcaagcggcaccagaacgtcagcatc
ctctatgctgacatcgtgggcttcacgcagctggccagcgactgctccccaaaagagttg
gtggtggtgctgaacgagctcttcggaaagttcgaccagatcgccaaggccaatgaatgc
atgcggatcaagatcctgggcgactgctactactgcgtgtcaggcttgcccgtgtccctg
cccagccacgcccgcaactgtgtgaagatggggctggacatgtgtgaggccattaagcag
gtgcgggaggccacaggcgtggacatcagcatgcgtgtgggcatacactcggggaacgtg
ctgtgcggtgtcatcgggctgcgcaagtggcagtatgatgtgtggtcccatgacgtgtcc
ctggccaacaggatggaggcagctggagtccctggccgggtgcacatcacagaggcgacg
ctgaaccacctggacaaggcgtatgaggtggaggacgggcacgggcagcagcgggacccc
tacctgaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagccg
cccccgcccagcctacacctcaccaagtccaagggggacgcgaccctgaagatgcgggcc
tccgtgcgcatgacccgctacctcgagtcctggggggcggcgcggcccttcgcacacctc
aaccaacgcgagaacgtgagcagcaatgagacccctgtgccccacgggcggaggcccaag
gccattcccctacggcgccaccggacccctgacagaagcgcgtcccccaaggggcggtca
gaggatgactcatatgatgatgagatgctgtcagccatcgagggcctcagctccacgaga
ccctgctgctccaagtctgatgacttctacacctttgggtccatcttcctggagaagggc
ttcgagcgagagtaccgcctggcacccatcccgcgggcccgctactactttgcttgtgcc
ggccttgtgttcatctgcatcctgctcgtccatgccctgctgatgcccaggatggcggct
ctgggtgtgtcctttgggctggtggcctgtgtgctcgggctggtactaggcttgtgcttt
gcccatgagctcttgaggtgctgcccagcccggggcgcgctccgagccatctccgagagg
gtggagacgcagcccctgctgcgggtgtccctggccgtcctgaccatcggcagcctgctc
gccgtcgccgttgtcaacctgccgctgatgcctttcccggccccagggctgcctgctggg
aacgagacgggcccgggggccgtgagcagctgggagagggccctgtgcaagctcctcccg
tattacacctgcagctgcatcctggccttcatcgcctgctctgtcttcctgcggatgagc
ctggagctgaaggtcgtgctgttgacagtggccttggtggcctacctggtgctcttcaac
atctccccgtgctggcagtgggactgctgtggccacagcctgggcaacctcaccaagacc
aatggcaccctcagctccccgtcctgttcatgggatctgaagacaatgatcaatttctac
ctggtcctgttttacaccaccctcatcatgctctccagacagattgactattactgccgc
ttggactgtctgtggaagaggaagttcaagaaggaacacgaggagtttgaaaccatggag
aatgtgaaccgccttcttctagagaatgtcctgccagcgcacgtggccgcccacttcatt
ggtgacaagttaaatgaggactggtaccaccagtcctatgactgcgtgtgtgtcatgttt
gcatctgtgccggacttcaaagtattctacacggagtgcgacgtcaacaaggaagggctg
gagtgcctgcgcctgttgaacgagatcatagctgactttgacgagctgctgttaaagccc
aagttcagtggtgtggagaagatcaagaccatcggcagcacgtacatggcagctgcaggg
ctcagcatcccctcagggcacgagaaccaggacctggagcggcagcacgcccacatcggc
atcatggtggagttcagcaccgccctgatgagcaagctggatggcatcaaccggcactcc
ttcaactccttccgcctccgagttggcataaaccacgggcccgtgattgctggagtgatt
ggggcacgaaaacctcagtacgacatctggggaaacacggtcaatgttgccagtcgaatg
gagagcaccggagaacttgggaaaatccaggttactgaagagacatgtaccatcctccag
ggactaggttattcttgtgaatgccgcggactgattaacgtcaaaggcaaaggcgaactg
cggacttactttgtctgtacggatactgccaagtttcaagggttggggctgaactga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103081539
Entry
103081539         CDS       T03090                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05142  Chagas disease
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103081539 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103081539 (ADCY1)
   04371 Apelin signaling pathway
    103081539 (ADCY1)
   04020 Calcium signaling pathway
    103081539 (ADCY1)
   04072 Phospholipase D signaling pathway
    103081539 (ADCY1)
   04024 cAMP signaling pathway
    103081539 (ADCY1)
   04022 cGMP-PKG signaling pathway
    103081539 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103081539 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103081539 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103081539 (ADCY1)
   04062 Chemokine signaling pathway
    103081539 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    103081539 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    103081539 (ADCY1)
   04912 GnRH signaling pathway
    103081539 (ADCY1)
   04913 Ovarian steroidogenesis
    103081539 (ADCY1)
   04915 Estrogen signaling pathway
    103081539 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    103081539 (ADCY1)
   04921 Oxytocin signaling pathway
    103081539 (ADCY1)
   04926 Relaxin signaling pathway
    103081539 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    103081539 (ADCY1)
   04918 Thyroid hormone synthesis
    103081539 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    103081539 (ADCY1)
   04916 Melanogenesis
    103081539 (ADCY1)
   04925 Aldosterone synthesis and secretion
    103081539 (ADCY1)
   04927 Cortisol synthesis and secretion
    103081539 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103081539 (ADCY1)
   04270 Vascular smooth muscle contraction
    103081539 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    103081539 (ADCY1)
   04971 Gastric acid secretion
    103081539 (ADCY1)
   04972 Pancreatic secretion
    103081539 (ADCY1)
   04976 Bile secretion
    103081539 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103081539 (ADCY1)
   04727 GABAergic synapse
    103081539 (ADCY1)
   04725 Cholinergic synapse
    103081539 (ADCY1)
   04720 Long-term potentiation
    103081539 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    103081539 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103081539 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    103081539 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    103081539 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103081539 (ADCY1)
   04714 Thermogenesis
    103081539 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103081539 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    103081539 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103081539 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103081539 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103081539 (ADCY1)
   05163 Human cytomegalovirus infection
    103081539 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103081539 (ADCY1)
   05142 Chagas disease
    103081539 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103081539 (ADCY1)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103081539 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 HNOBA
Other DBs
NCBI-GeneID: 103081539
NCBI-ProteinID: XP_007447087
UniProt: A0A340WHT5
LinkDB
Position
Un
AA seq 1134 aa
MAGAPRGRGGGGGGGGAGESGGAERAAGPGGRRGLRACNEEFACPELEALFRGYTLRLEQ
AATLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQ
LQQVGQLALLFSLTFALLCCPFALGGPAGAHAGAAAVPVAADQGVWQLLLVTFVSYALLP
VRSLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFLGVNMYGVFVRILAERS
QRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQR
HDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVS
GLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDV
WSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGHGHERNSFLKTHNIETFFIVP
SHRRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRA
LRTASEKLRNRSSFSTNVVYTTPGTRVNRYIGRLLEARQMELEMADLGFFTLKYKQAERE
RKYHQLQDEYFTSAVILALILAALFGLVYLLIIPQSVAVLLLLVFCICFLVACVLYLHIT
RVQCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWNSSPNGSLVILSSGRRDRV
LPSPPCESAPHALLCGLVGTLPLAVFLRVSSLPKMILLAVLTTSYILVLELGGYTKAVGG
DAVSGRSFEPIVAILLFSCTLALHARQVDVKLRLDYLWAAQAEEERGDMERVKLDNKRIL
FNLLPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLL
NEIIADFDELMDRDFYKDLEKIKTIGSTYMAAVGLAPAAGTKAKKCISSHLSTLADFAIE
MFDVLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGR
IQVTEEVHRLLRRGCYRFVCRGKVSVKGKGEMLTYFLEGRTDGSGSQNRSVNSERKMCPY
GRAGLQTRLATGHPPVPPAAGLPVRAGPAALQGSGLAPCPPGHHLPPGAAGKEA
NT seq 3405 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggccgaggcggcggcggaggcggaggcggcgcgggcgagtct
gggggcgccgagcgggcggcggggccgggcggccggcgcgggctacgggcgtgcaacgag
gagttcgcgtgccccgagctggaggcgctgttccgcggctacacgctgcggctggagcag
gcggccacgctgaaggcgctggccgtgctcagcctactggcgggcgcgctggccctggcc
gagctgctgggcgcgccggggcccgcgcccggcctggccaagggctcgcaccccgtgcac
tgcgtgctcttcctggcgctgctcgtggtcaccaacgtccgctcgctgcaggtgccccag
ctgcagcaggtcggccagctcgcgctgctcttcagcctcaccttcgcgctgctctgctgt
cccttcgcgctcggcggccccgccggggcccacgcaggggcggcagcggtgccggtggca
gccgaccagggcgtctggcagctccttttggtcaccttcgtgtcctatgccctgctgccc
gtgcgcagcctgctggccatcggcttcgggctcgtggtggccgcctcgcatttgctggtc
acggctaccttggtccccgccaagcgcccacgtctctggaggacgctcggtgccaacgcc
ctgctcttccttggcgtgaacatgtacggggtcttcgtgaggatcctggctgagcgctcc
cagaggaaggccttcctgcaggcccggaactgcatcgaggaccggctgaggctggaggat
gagaatgagaagcaggagcggctgctcatgagtctcctgccccggaacgtcgccatggag
atgaaggaggacttcctgaagccccccgagaggattttccacaagatctacatccagcgg
catgacaacgtgagcatcctctttgcagacatcgtgggcttcacgggcttggcgtcgcag
tgcacggcccaggagctggtgaaactcctcaatgagctcttcggcaagtttgacgaactg
gccacggagaaccactgccgtcgcatcaagatcctgggagactgctactactgcgtgtcc
ggcctcactcagcccaagactgaccacgcccactgctgtgtggagatgggcctggacatg
atcgacaccatcacgtccgtggccgaggccactgaggtggacctgaacatgcgcgtgggg
ctgcacaccggcagagtcctctgcggggtcctgggcctgcgcaagtggcagtacgacgtg
tggtccaacgacgtgaccctggcgaacgtcatggaagccgccggcctgcctgggaaggtt
cacatcacaaagaccaccctggcgtgcctgaatggtgactatgaggtggagccgggccat
ggacacgagaggaacagttttctgaaaactcacaacattgagacctttttcatcgtgccc
tcccatcggcgaaagatatttccagggctgattctctcagatataaaaccggccaagaga
atgaagttcaagaccgtgtgctacctgctggtgcagctcatgcactgccggaagatgttc
aaggctgagatccctttctccaatgtcatgacctgcgaggacgacgacaagcggagggca
ctgagaacagcctcggaaaaactcagaaaccgctcatctttctctacaaacgttgtctac
accacccctgggacacgcgtcaacaggtacattggacgcctcctggaagcccgccagatg
gagctggagatggcggacctgggcttcttcacgctaaagtacaagcaggccgaacgagag
cgaaagtatcaccagcttcaggacgagtatttcaccagcgccgtcattctggccctcatc
ctggccgccttatttggccttgtctaccttctaataatcccgcagagcgtggccgtcctc
ctcctgctggtgttctgcatatgcttcctggtggcctgtgtcctgtatctacacatcacc
cgggtccagtgttttccagggtgcctgacgatccagatccgcaccgtcctgtgtatcttc
atcgtggtcttaatctactccgtggcccaaggctgtgtggtgggctgcctgccttgggcc
tggaactccagtcccaatgggtccctggtgatcctgtcgtctgggcgccgggaccgcgtg
ctgccctccccgccctgcgagtctgcaccccacgccctgctgtgtggcctcgtgggcacc
ctcccactggctgtattcctgcgggtgtcctccttgccaaaaatgatcctgcttgccgtg
cttaccacctcctacatcctcgtcctggagctcggcgggtacacgaaggccgtggggggt
gacgccgtctcgggccgcagctttgagccgattgtggccatcctcctgttctcgtgcacg
ctggccctgcacgcccggcaggtggacgtcaagctgcggctggactacctgtgggccgca
caggcagaggaggagaggggcgacatggagagggtgaagctggacaacaagaggattctc
ttcaacctcctgccggcccacgtcgcccagcacttcctcatgtccaacccccgaaacatg
gacctgtactaccagtcgtactcgcaggtgggggtcatgttcgcctccatccccaacttc
aatgacttctacatcgagctggatggcaacaacatgggcgtggagtgtctgcgcctactc
aacgagatcatcgccgactttgacgagctcatggacagagacttttacaaggacctggag
aagatcaagaccatcggaagcacctacatggctgccgtggggctggcgcccgcggccggg
accaaggctaagaagtgcatctcctcccacctcagcacattggcagattttgccatcgag
atgtttgacgtcctggatgagatcaactaccagtcttacaacgactttgtgctccgtgtt
ggcatcaacgttggccccgtggtggctggagtgatcggggctcgcaggccgcagtacgac
atctggggaaatacggtcaacgtggccagtcggatggacagcaccggcgtccagggcaga
atccaggtcacggaggaagttcacaggctgctgcggcggggctgctaccgcttcgtgtgc
cgaggcaaagtcagtgtcaagggcaagggtgagatgctgacatacttcctggaaggcagg
accgacggaagcggctcccaaaacaggtccgtgaactcagagcggaaaatgtgtccttac
gggagagccggcctccagaccagactggccacgggccaccccccggtgccccctgcggcc
ggcctcccagtcagagccgggccagcggctctgcagggctcggggcttgccccctgcccc
ccaggccaccacctgccccccggagcagctgggaaggaggcttag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084817
Entry
103084817         CDS       T03090                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103084817 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103084817 (ADCY2)
   04371 Apelin signaling pathway
    103084817 (ADCY2)
   04020 Calcium signaling pathway
    103084817 (ADCY2)
   04072 Phospholipase D signaling pathway
    103084817 (ADCY2)
   04024 cAMP signaling pathway
    103084817 (ADCY2)
   04022 cGMP-PKG signaling pathway
    103084817 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103084817 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103084817 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103084817 (ADCY2)
   04062 Chemokine signaling pathway
    103084817 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    103084817 (ADCY2)
   04922 Glucagon signaling pathway
    103084817 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    103084817 (ADCY2)
   04912 GnRH signaling pathway
    103084817 (ADCY2)
   04913 Ovarian steroidogenesis
    103084817 (ADCY2)
   04915 Estrogen signaling pathway
    103084817 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    103084817 (ADCY2)
   04921 Oxytocin signaling pathway
    103084817 (ADCY2)
   04926 Relaxin signaling pathway
    103084817 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    103084817 (ADCY2)
   04918 Thyroid hormone synthesis
    103084817 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    103084817 (ADCY2)
   04916 Melanogenesis
    103084817 (ADCY2)
   04925 Aldosterone synthesis and secretion
    103084817 (ADCY2)
   04927 Cortisol synthesis and secretion
    103084817 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103084817 (ADCY2)
   04270 Vascular smooth muscle contraction
    103084817 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    103084817 (ADCY2)
   04971 Gastric acid secretion
    103084817 (ADCY2)
   04972 Pancreatic secretion
    103084817 (ADCY2)
   04976 Bile secretion
    103084817 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103084817 (ADCY2)
   04727 GABAergic synapse
    103084817 (ADCY2)
   04725 Cholinergic synapse
    103084817 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    103084817 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103084817 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    103084817 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    103084817 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103084817 (ADCY2)
   04714 Thermogenesis
    103084817 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103084817 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    103084817 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103084817 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103084817 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103084817 (ADCY2)
   05163 Human cytomegalovirus infection
    103084817 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103084817 (ADCY2)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103084817 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 103084817
NCBI-ProteinID: XP_007447983
UniProt: A0A340WEH1
LinkDB
Position
Un
AA seq 1052 aa
MSQQHPLIVFLLLIVMGACLALLAVFFALRLEVEDHVAFLITVPTALAIFFAIFILVCIE
SVFKKLLRLFSLVIWICLVAMGYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAI
IASVLTSSSHTVVLSVCLSAMPGAKDHVVWQILANVIIFICGNLAGAYHKHLMELALQQT
YQDTCNCIKSRIKLEFEKRQQERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFH
NLYVKRHTNVSILYADIVGFTRLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGD
CYYCVSGLPISLPNHAKNCVKMGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQ
KWQYDVWSHDVTLANHMEAGGVPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVK
TYFVINPKGERRSPQHLFRPRSTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTE
NGKISTTDVPMGQHNFQSRTLRTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRI
SLLFYNKILEKEYRATALPAFKYYVTCACLIFFCIFIVQILVLPKTSILGISFGAAFLSL
AFILFVCFAGQLLQCSKKASASLLWLLKSSGIIAKRPWPRISLTAITTAIILTMAVFNMF
FLSESEEMILPTANASNTSLPALYSQVAMLRAQNLFFLPYFIYSCILGLISCSVFLRVNY
ELKMLIMMVALVGYNTIFLHTHAHLLDDYSQVLFERPGIWKDLKTMGSVSLFIFFITLLV
LGRQNEYYCRLDFLWKNKFKKEREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEDLY
HQSYDCVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIK
TIGSTYMAATGLSAVPSQEHSQEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRV
GINHGPVIAGVIGAQKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSLILQTLGYTCTC
RGIINVKGKGDLKTYFVNTEMSRSLSQSNLAS
NT seq 3159 nt   +upstreamnt  +downstreamnt
atgagccagcagcacccgctcatcgtcttcctgcttctcatcgtcatgggcgcctgcctc
gccctgctcgccgtcttcttcgctctccggctggaagttgaagaccacgtggcattttta
ataacagttccgactgccctggcgattttctttgctatcttcatcctcgtgtgcatcgag
tcagtgtttaagaagctactccgccttttttctttggtgatatggatttgtctcgtggcc
atgggctacttgttcatgtgttttggaggcaccgtgtctccctgggaccaggtgtcattc
ttcctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagatgccatc
atcgccagtgtccttacctcctcttcccacaccgtcgtgctgagtgtctgcctgtctgca
atgccgggggccaaggaccacgtggtctggcagatcctggccaatgtgatcatcttcatc
tgcgggaacctggccggggcgtaccataagcacctcatggaactcgctctgcagcagacg
tatcaggacacttgcaattgcatcaagtcccggatcaagttggaatttgaaaagcgtcag
caggagcggcttctgctgtccctgctgccagcgcacatagccatggagatgaaagccgag
atcatccagaggctgcagggccccaaagccggccaaatggaaaacaccaacaactttcac
aacctgtacgtcaagcggcacaccaacgtcagtatcctctatgcggacattgttgggttc
acccgtctggccagtgactgctccccaggagaactggtccacatgctgaatgaactcttt
ggaaaatttgatcaaattgcaaaggagaatgaatgcatgagaataaaaattctaggagac
tgctactactgtgtttccggactccctatctctctccctaaccatgccaagaattgtgtg
aaaatgggactggatatgtgtgaagccataaagaaagtgagggacgccactggagtggac
atcaacatgcgcgtaggagtgcattctgggaacgtcctctgcggcgtgattgggctgcag
aagtggcagtacgacgtatggtcccatgacgttaccctggccaaccacatggaagctgga
ggggtccctggacgtgttcacatttcttccgtcacactggaacacttgaatggggcttat
aaagtggaggaaggagatggtgacatcagagacccatatttaaagcagcacttggtgaag
acctactttgtaatcaaccccaagggagaacgacggagcccccagcacctcttcagacct
cgatccaccctcgatggagccaagatgagggcttccgtccgcatgacccggtacctggag
tcctggggggcggccaagccctttgcacacctgcatcacagagacagcatgaccacggag
aacggcaagatcagcaccacggatgtaccaatgggtcagcataattttcaaagtcgcacc
ttaagaaccaagtcacaaaagaaaagatttgaagaggaattaaatgaaaggatgattcaa
gcaattgatggaatcaatgcacaaaagcaatggctcaagtctgaagacattcagagaatc
tcattgcttttctacaataaaatactagaaaaagaataccgagccactgcgctgccagcc
ttcaagtattacgtgacctgcgcctgcctcatattcttctgtatcttcatcgtgcagatc
ctggtcttacccaaaacatccattctcgggatttcctttggagctgcatttctctcgctt
gcctttatccttttcgtctgctttgctggacagcttttgcaatgcagcaaaaaagcatcc
gcctctctcctgtggcttttaaagtcgtcgggcatcatcgccaagcgcccctggcctcgg
atctccctgacagccatcaccacagccatcatactaaccatggccgtgttcaacatgttt
ttcctgagcgagtcagaggagatgattcttccaactgccaatgcgtcaaacacaagtctt
cctgccttatatagtcaggtagcaatgctgcgtgcgcaaaatttgtttttcctgccgtac
tttatatacagctgcatcctgggattgatatcctgttcggttttcctgcgcgtgaattat
gagctaaagatgctgatcatgatggtggcattggtgggctacaacaccatctttctccac
actcacgcccacctcctggatgactacagccaggtcttatttgagagaccaggcatttgg
aaagacctaaagaccatgggctcagtgtctctctttatatttttcatcacactgcttgtt
ctgggcagacagaatgaatattactgtaggttagacttcttatggaagaacaagttcaaa
aaagagcgagaggagatagaaaccatggagaacttgaaccgcgtgctgctggagaacgtg
ctccctgcacacgtggctgagcacttcctggccaggagcctgaagaatgaggatttatac
caccagtcctatgactgtgtctgcgtcatgtttgcctccattccggatttcaaagaattc
tatacagaatcggatgtgaacaaggagggcttggaatgccttcggctcctaaacgagatc
attgccgactttgacgatctgctgtccaagccaaagttcagtggagttgaaaagatcaag
accatcggcagcacgtacatggcggcgacgggtctgagtgccgtgcccagccaggagcac
tcccaggagcctgagaggcagtacatgcacattggcaccatggtggagtttgcattcgcc
ttggtggggaaactggacgccatcaacaagcactccttcaacgacttcaagttacgagta
ggtattaaccatggccctgtaatagccggtgtgattggagctcagaagccacagtacgat
atctggggcaacaccgtaaatgtggccagtaggatggacagcaccggcgtcctggacaaa
atccaggttactgaggagacgagcctcattctgcagaccctggggtacacgtgcacatgt
cgaggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtgaacacagag
atgtcacggtccctttcccagagcaacctggcatcctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103085845
Entry
103085845         CDS       T03090                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase 8
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103085845 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103085845 (ADCY8)
   04371 Apelin signaling pathway
    103085845 (ADCY8)
   04020 Calcium signaling pathway
    103085845 (ADCY8)
   04072 Phospholipase D signaling pathway
    103085845 (ADCY8)
   04024 cAMP signaling pathway
    103085845 (ADCY8)
   04022 cGMP-PKG signaling pathway
    103085845 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103085845 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103085845 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103085845 (ADCY8)
   04062 Chemokine signaling pathway
    103085845 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    103085845 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    103085845 (ADCY8)
   04912 GnRH signaling pathway
    103085845 (ADCY8)
   04913 Ovarian steroidogenesis
    103085845 (ADCY8)
   04915 Estrogen signaling pathway
    103085845 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    103085845 (ADCY8)
   04921 Oxytocin signaling pathway
    103085845 (ADCY8)
   04926 Relaxin signaling pathway
    103085845 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    103085845 (ADCY8)
   04918 Thyroid hormone synthesis
    103085845 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    103085845 (ADCY8)
   04916 Melanogenesis
    103085845 (ADCY8)
   04925 Aldosterone synthesis and secretion
    103085845 (ADCY8)
   04927 Cortisol synthesis and secretion
    103085845 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103085845 (ADCY8)
   04270 Vascular smooth muscle contraction
    103085845 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    103085845 (ADCY8)
   04971 Gastric acid secretion
    103085845 (ADCY8)
   04972 Pancreatic secretion
    103085845 (ADCY8)
   04976 Bile secretion
    103085845 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    103085845 (ADCY8)
   04727 GABAergic synapse
    103085845 (ADCY8)
   04725 Cholinergic synapse
    103085845 (ADCY8)
   04720 Long-term potentiation
    103085845 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    103085845 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    103085845 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    103085845 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    103085845 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    103085845 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103085845 (ADCY8)
   04714 Thermogenesis
    103085845 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103085845 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    103085845 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103085845 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103085845 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103085845 (ADCY8)
   05163 Human cytomegalovirus infection
    103085845 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103085845 (ADCY8)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103085845 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 103085845
NCBI-ProteinID: XP_007448050
UniProt: A0A340WM11
LinkDB
Position
Un
AA seq 1250 aa
MELSDVRCLSGSEDLYTIHPTPPAGDGGSASRPPRLLWQTAVRHITEQRFVHGHRGSGGG
SGSSSKASDPVGGGPNHHASQLAGDSALPLYALGPGERAHSPGCTKVFPERSGSGGGGGS
GGAGDLGFLHLDCAPSNSDFFLKGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRKS
EVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHTY
LQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTIFATYSMLPLPLTWAILAGLGTSF
LQVVLQGVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARL
RLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVK
GFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHC
CVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLE
SGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEESLLSLPEDI
VKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHVQ
SGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAFI
VLLFITAIQSLLPSSRVMPMAIQFSILIMLHSALVLITTAEDYKCLPLVLRKTCCWINET
YLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTGV
LAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETIYAGLFLRYDNLNHSGEDFLGTKEAS
LLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVAR
HFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDEL
LGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWEHLCALADFSLALTESIQEINKHS
FNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILK
DQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ
SLNRQRQKQLLNENNNTGIIKGHYNRRTLLTPSGPEPGAQVEGTDKSELP
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttagcggcagcgaggacctctacaccatccacccg
acgcccccggccggcgacggcgggagcgcctcccggccgccgcggctgctgtggcaaacg
gcggtgcggcacatcaccgagcagcgcttcgtacacgggcatcggggcagcggcggcggg
agcggaagctccagcaaagcctcggaccctgtaggcggcggccccaaccaccacgcgtcg
cagctggccggcgactcggcgctgcccctctacgcgctgggccccggggagagagctcac
agccccggctgcaccaaagtcttcccggaacgcagcggcagcggcggcggcggcggcagc
gggggcgcgggcgacctgggcttcctgcacctcgactgcgccccgagcaactcggatttc
ttcctcaaggggggctatagctaccgaggggtcattttccccaccctgcgcaactccttc
aagtcccgggatctggagcgcctctaccagcgctatttcctgggccagaggcgcaaatcg
gaggtggtgatgaacgtgctggacgtgctgaccaaactcaccctcttggttctccacttg
agcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacgggc
atagaggtggtgatctgcgccttggtggtggtcaggaaggacaccacctcgcacacctac
ctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcttagcagcaggt
ctgggctatgggctcctgggagacggcattggctacgtgctcttcacaatcttcgccacc
tacagcatgctgccgctgccgctcacctgggccatcctggctggcctgggcacgtcgttc
ctgcaggtggtcctccaaggggtcatccccaggctggcggtcatttctatcaaccaggtt
gtggcccaggcagtgttattcatgtgtatgaacacagctggaatctttatcagttacctg
tcagaccgggcccagcgccaagccttcctggagacgcggaggtgtgtggaagccaggctg
cgcctagagacggaaaaccaaagacaggagcggcttgtgctgtctgtgctccctcggttt
gtcgtcctggagatgatcaatgacatgaccaacgtggaagacgagcacctgcagcatcaa
ttccaccggatctacatccaccgctacgagaatgtcagtattctttttgcagatgtcaaa
ggatttaccaacctctccacgaccttgtctgcccaggagctggtcaggatgctcaacgag
ctctttgccagatttgatcgactggcccatgagcatcactgccttcgcattaaaatcctg
ggagactgctactactgcgtttcgggacttcctgagccccgccaggaccacgcccactgc
tgcgttgaaatgggcctcagcatgatcaaaaccatcaggtatgtgcggtcaaggacgaag
catgatgttgacatgcggattggaatccactcgggctcagtgctatgtggcgtgttgggt
ctacggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaacttgaa
tctggaggaatccctgggaggattcacatttccaaagccacgctggactgcctcaacggt
gactataatgtggaagagggtcatggtaaagagaggaacgaattcttgaggaagcataat
atagagacctatttaattaagcagcctgaggagagtctgctgtctttgcctgaagacatc
gtcaaggaatctgtgagctcctcagacaggagaaacagtggggcgacattcacagaagga
tcctggagccccgaactgccctttgataacatagtggggaaacagaacactctggctgcc
ctaacaagaaattcaataaatctacttccaaaccatcttgcacaagctttgcatgtccag
tctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggcgat
aaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctggag
cacaagtattctcaaatgagggacgaagtattcaaatcaaacttggtctgtgcgtttatc
gttcttctatttatcacggcaatacaaagtttgcttccttcttcaagggtgatgccaatg
gccatccagttttccatcctgattatgctgcactcggctttggtcctcatcaccacagcg
gaggattataagtgtttgcccctggtcctccggaaaacttgctgttggattaacgagacc
tatttggccaggaatgtcatcatctttgcgtccatcttgattaatttcctgggcgccatc
ctaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttcaat
tcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggggtg
ttggccatggtgacctgtgcggttttcctccgacttaactctgtcctgaagctggctgtg
ctgctgattatgattgccatctatgccctgctgaccgagaccatctatgcaggactcttt
ctgcgctatgacaacctgaatcacagtggagaagatttcctggggaccaaggaggcgtca
ctgctgctgatggccatgttcctcctcgctgtcttctaccatggacagcagctggagtac
acagcacgcctggacttcctctggcgagttcaggccaaagaggagatcaacgagatgaag
gagctgagggaacacaatgagaacatgctccggaacatcctgcccagtcacgtggcccgc
cacttcctagagaaggaccgcgacaatgaggagctgtattctcaatcctatgatgccgtt
ggggtgatgtttgcctccatcccagggtttgcagacttctactctcagactgaaatgaac
aaccaaggagtggaatgcctacgcctgctgaatgagatcattgccgacttcgatgagctg
cttggtgaagaccggtttcaagacattgaaaagattaagaccattggcagcacctacatg
gccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagataagtgggaacatttgtgt
gccctggccgacttctctctcgccctgacggaaagcatacaggagatcaacaagcattct
ttcaacaattttgagctccggattggcatcagtcacggctcagtggtagctggcgttatc
ggcgctaagaaaccacaatacgacatttggggcaaaaccgtgaacctggcaagtcgaatg
gacagcacgggagtcagcggcagaatccaggtcccagaggagacctatctcatcctgaag
gaccagggctttgcctttgactaccgaggggagatctatgtgaagggcatcagtgaacag
gaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatcctg
ccgccgagaagactgcccgggcagtactccttggccgcggtcgtcctgggcctcgtccag
tccctcaacaggcaaaggcagaagcagctgctgaatgagaacaacaacacgggcatcatc
aagggccattacaaccggcggactttgctgacacccagtgggcctgagccgggagcccaa
gtcgaaggcaccgacaagtccgagttgccatag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091169
Entry
103091169         CDS       T03090                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase 5
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05012  Parkinson disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05034  Alcoholism
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103091169 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103091169 (ADCY5)
   04371 Apelin signaling pathway
    103091169 (ADCY5)
   04072 Phospholipase D signaling pathway
    103091169 (ADCY5)
   04024 cAMP signaling pathway
    103091169 (ADCY5)
   04022 cGMP-PKG signaling pathway
    103091169 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103091169 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103091169 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103091169 (ADCY5)
   04062 Chemokine signaling pathway
    103091169 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    103091169 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    103091169 (ADCY5)
   04912 GnRH signaling pathway
    103091169 (ADCY5)
   04913 Ovarian steroidogenesis
    103091169 (ADCY5)
   04915 Estrogen signaling pathway
    103091169 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    103091169 (ADCY5)
   04921 Oxytocin signaling pathway
    103091169 (ADCY5)
   04926 Relaxin signaling pathway
    103091169 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    103091169 (ADCY5)
   04918 Thyroid hormone synthesis
    103091169 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    103091169 (ADCY5)
   04916 Melanogenesis
    103091169 (ADCY5)
   04924 Renin secretion
    103091169 (ADCY5)
   04925 Aldosterone synthesis and secretion
    103091169 (ADCY5)
   04927 Cortisol synthesis and secretion
    103091169 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103091169 (ADCY5)
   04270 Vascular smooth muscle contraction
    103091169 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    103091169 (ADCY5)
   04971 Gastric acid secretion
    103091169 (ADCY5)
   04972 Pancreatic secretion
    103091169 (ADCY5)
   04976 Bile secretion
    103091169 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    103091169 (ADCY5)
   04727 GABAergic synapse
    103091169 (ADCY5)
   04725 Cholinergic synapse
    103091169 (ADCY5)
   04728 Dopaminergic synapse
    103091169 (ADCY5)
   04726 Serotonergic synapse
    103091169 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    103091169 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103091169 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    103091169 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    103091169 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103091169 (ADCY5)
   04714 Thermogenesis
    103091169 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103091169 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103091169 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    103091169 (ADCY5)
   05031 Amphetamine addiction
    103091169 (ADCY5)
   05032 Morphine addiction
    103091169 (ADCY5)
   05034 Alcoholism
    103091169 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103091169 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103091169 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103091169 (ADCY5)
   05163 Human cytomegalovirus infection
    103091169 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103091169 (ADCY5)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103091169 (ADCY5)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD
Other DBs
NCBI-GeneID: 103091169
NCBI-ProteinID: XP_007449752
UniProt: A0A340WQ40
LinkDB
Position
Un
AA seq 1263 aa
MSSSKSVSPPGYAAQTAAAPASRGGPEHRSAWGEADSRANGYPHAPGGSARGSTKKPGGT
VTPQQQQQQRLASRWRSDDDDDPPLSGDDPLAGGFGFSFRSKSAWQERGGDDCGRGSRRQ
RRGAAGGGSTRAPPAGGGXXXXXXXAPAAAGGTEVRPRSVELGLEERRGKGRAADELEAG
AVEEDEGSGDGGSLAGSGAGPGAVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLN
QSSLTMLMAVLVLVCLVMLAFHAARPPLQLPYLAVLAAAVGVILVMAVLCNRAAFHQDHM
GLACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLS
ALHLAIALRTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQAR
LHSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGF
TSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCV
EMGMDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAG
GKAGRIHITKATLNYLNGDYEVEPGGGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAK
MNRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDE
FLGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFV
QITIVPHSVFMLSFYLTCFLLLTVVVFVSVIYSCVKLFPAPLQRLSRKIVRSKMNSTLVG
VFTITLVFLSAFVNMFTCNSKDLIGCLADEHNISASQVSTCHVVESAGNYSLGDERGFCG
SPWPNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAVELIYVLVVEVPGVTLFDNA
DLLVTANAVDFNNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLW
KLQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIA
NFSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDS
TYDKVGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDI
WGNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGP
PPS
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgtccagctccaaaagcgtgagccccccgggctacgcggcgcagacagcggcggcgccg
gcgtcccggggaggcccggaacaccgctcggcgtggggcgaggccgactcccgcgccaat
ggctacccccacgcccccgggggttcggcccgcggctccaccaagaaacccggggggacg
gtgaccccgcagcagcagcagcagcagcgcctggccagccgctggcgcagcgacgacgac
gacgatcctccgctgagtggcgatgaccccctggctgggggcttcggcttcagtttccgt
tccaagtcggcctggcaggagcgcggcggcgacgactgcggtcgcggcagccggcggcag
cggcggggcgcggccggcgggggcagcacccgggcgccccctgcgggcggcggnnnnnnn
nnnnnnnnnnnnnnngcgcccgccgcagctggcgggacggaggtgcgcccccgttctgtg
gagctgggtctggaggagcggcggggcaagggccgcgcggccgacgagctggaggccggc
gccgtcgaggaagacgagggttccggagatggcggcagcttggcaggctcaggcgcgggc
cctggcgcggtgctgtcgctgggcgcctgctgcctggcgctgctgcagatattccgctcg
aagaagttcccgtcggacaagctggagcggctgtaccagcgctacttcttccgtctgaac
cagagcagcctcactatgctcatggctgtgctggtgctcgtgtgcctcgtcatgttggcc
ttccacgcggcacggcccccgctgcagctgccctacctggccgtgctggcggctgcagtg
ggtgtgatcctcgtcatggccgtgctctgcaaccgcgccgccttccaccaggaccacatg
ggcctggcctgctacgcgctcatcgccgtggtgctggctgtccaggtggtgggcctgctg
ctgcctcagccgcgcagcgcctccgagggcatctggtggactgtgttcttcatctatacc
atctacacgctgctgcccgtgcgcatgcgggccgcggtactcagcggggtgctcctgtct
gccctccacctggccatcgccctgcgcaccaacgcccaggaccagttcctgctcaagcag
ctcgtctccaatgtcctcattttctcctgcaccaacatcgtgggcgtctgcacccactac
ccggctgaggtctcccagagacaggccttccaggagacccgggagtgcatccaggctcgg
ctgcactcgcagcgggagaaccagcagcaggagcggctcctgctgtctgtccttccccgt
cacgttgccatggagatgaaagcagacatcaatgccaaacaggaagatatgatgttccat
aaaatttacatccagaaacatgacaacgtgagcatcctgtttgcggacatcgagggcttc
accagcctggcgtcccagtgcactgcccaggagcttgtcatgaccctcaacgagctcttc
gcccgcttcgacaagctggctgcagagaatcactgtttacgtattaagatcctgggagat
tgttattactgcgtctcagggctgcctgaagccagggctgaccatgcccactgctgcgtg
gagatgggcatggacatgattgaggccatctcgctggtccgggaggtgacaggtgtcaac
gtgaacatgcgtgtgggaatccacagcggtcgagtgcactgtggcgtccttggcctcagg
aagtggcagttcgacgtctggtctaacgacgtcacgctggccaaccacatggaggctgga
ggcaaggcgggacgcatccacatcaccaaggccacactcaactacctgaatggcgactac
gaagtggagccgggcggtgggggcgagcgcaacgcctacctcaaagagcacagtatcgag
accttcctcatcctgcgctgcacccagaagcggaaagaagagaaggccatgattgccaag
atgaatcgtcagagaaccaactcgatcgggcacaacccaccacactggggggccgagcgc
cccttctacaaccacctgggtggcaaccaggtgtccaaggagatgaaacggatgggcttt
gaagatcccaaggacaagaacgcccaggaaagtgcgaaccccgaggatgaagtggatgaa
tttctgggccgtgccattgacgccaggagcatcgacaggctacgatctgagcatgttcgc
aagttcctcttgaccttcagggagcctgacttagagaagaagtactccaagcaggtggat
gaccgattcggtgcctacgtggcatgtgcctcgctcgtcttcctcttcatctgctttgtc
cagatcaccattgtgccccactccgtgttcatgttgagtttctacctgacctgtttcctg
ctgctgaccgtggtggtatttgtttccgtgatctactcctgtgtgaagctcttcccggcc
ccgctgcagaggctctccaggaagatcgtgcggtccaagatgaacagcaccctggtgggc
gtgttcaccatcaccctggtgttcctgtcggcttttgtcaacatgttcacgtgcaactcc
aaggacctgattggctgcctggcggacgaacacaacatcagtgccagccaggtcagcacg
tgccacgtggtggagtcagccggcaactacagcctgggtgatgagcggggcttctgcggc
agcccctggcccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctg
ctggcctgctccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggcc
gtcgaactcatctacgtgcttgtcgttgaggtgcccggagtcacgctctttgacaatgcc
gacctactggtcacagccaacgccgtagacttcaacaacaacgggacctcccagtgccct
gagcacgcgaccaaggtggcgctgaaggtggtgacgcccatcatcatctccgtctttgtg
ctggccctgtacctgcacgcccagcaggtggagtccaccgcccgcctcgacttcctctgg
aaactgcaggccaccgaggagaaggaggagatggaggagctgcaggcctacaaccggcgg
ctgctgcacaacatcctgcccaaggacgtagccgcgcacttcctggcccgcgagcggcgc
aatgatgagctctactatcagtcgtgtgagtgcgtggccgtcatgttcgcctccatcgcc
aacttctccgagttctacgtggagctggaggccaacaacgagggcgtcgagtgcctgagg
ctgctcaacgagatcatcgctgactttgacgagatcatcagtgaggaccggttccggcag
ctggaaaagatcaagaccatcggcagcacctacatggccgcctcgggcctcaacgactcc
acctatgacaaggtgggcaagacgcacatcaaagctctggctgacttcgccatgaagctg
atggaccaaatgaagtacatcaacgagcactccttcaacaacttccagatgaagattggg
ctcaatatcggccccgtagtggctggggtgattggggcccgcaaacctcagtacgacatc
tggggcaacacagtgaacgtggccagccgcatggacagcaccggcgtgcccgaccgcatc
caggtcaccacagacatgtaccaggtgctggccgccaacacgtaccagctggagtgccgg
ggtgtggtcaaggtcaagggcaaaggcgagatgatgacatacttcctcaacggagggccc
ccgcccagttag

DBGET integrated database retrieval system