KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070701
Entry
103070701         CDS       T03090                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04012  ErbB signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04110  Cell cycle
lve04151  PI3K-Akt signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve05162  Measles
lve05165  Human papillomavirus infection
lve05169  Epstein-Barr virus infection
lve05200  Pathways in cancer
lve05202  Transcriptional misregulation in cancer
lve05203  Viral carcinogenesis
lve05206  MicroRNAs in cancer
lve05215  Prostate cancer
lve05220  Chronic myeloid leukemia
lve05222  Small cell lung cancer
lve05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103070701 (CDKN1B)
   04066 HIF-1 signaling pathway
    103070701 (CDKN1B)
   04068 FoxO signaling pathway
    103070701 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    103070701 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103070701 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103070701 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    103070701 (CDKN1B)
   05206 MicroRNAs in cancer
    103070701 (CDKN1B)
   05203 Viral carcinogenesis
    103070701 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    103070701 (CDKN1B)
   05220 Chronic myeloid leukemia
    103070701 (CDKN1B)
   05215 Prostate cancer
    103070701 (CDKN1B)
   05222 Small cell lung cancer
    103070701 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103070701 (CDKN1B)
   04934 Cushing syndrome
    103070701 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    103070701 (CDKN1B)
   05169 Epstein-Barr virus infection
    103070701 (CDKN1B)
   05165 Human papillomavirus infection
    103070701 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103070701 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103070701
NCBI-ProteinID: XP_007469390
UniProt: A0A340YD89
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSSQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcccggtcaatcacgaagag
ttaacccgggacttggagaagcactgtagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccttggagggcaaatacgagtggcaagaggtggaa
aagggcaacttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagcgggacccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagaccagaagactgatgccccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tcttctcaaaacaaaagagcaaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagccgggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system