KEGG   Lipotes vexillifer (Yangtze River dolphin): 103070954Help
Entry
103070954         CDS       T03090                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00010  Glycolysis / Gluconeogenesis
lve00030  Pentose phosphate pathway
lve00051  Fructose and mannose metabolism
lve00052  Galactose metabolism
lve01100  Metabolic pathways
lve01200  Carbon metabolism
lve01230  Biosynthesis of amino acids
lve03018  RNA degradation
lve04152  AMPK signaling pathway
lve05230  Central carbon metabolism in cancer
Module
lve_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103070954 (PFKP)
   00030 Pentose phosphate pathway
    103070954 (PFKP)
   00051 Fructose and mannose metabolism
    103070954 (PFKP)
   00052 Galactose metabolism
    103070954 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    103070954 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    103070954 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    103070954 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lve01009]
    103070954 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lve03019]
    103070954 (PFKP)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     103070954 (PFKP)
Protein phosphatases and associated proteins [BR:lve01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103070954 (PFKP)
Messenger RNA biogenesis [BR:lve03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     103070954 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 103070954
NCBI-ProteinID: XP_007465896
UniProt: A0A340XX08
LinkDB All DBs
Position
Un
AA seq 791 aa AA seqDB search
MGDHDVSPNPKGSFRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKDFRSREGRLKAAHNLLQLGI
TNLCVIGGDGSLTGANIFRKEWSGLLEELAREGKINTEEVQKHGYLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKAITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDSQIPKSNCNVGIVNVG
APAAGMNAAVRAAVRVGIADGHKVFAVYDGFEGFAKGQVKEIGWADVGGWTGQGGSILGT
KRTLPGKYLEDIATQMRTHGINALLIIGGFEAYLGLLELSAAREKHKEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDMCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISTKLKEPAGRGKRFVSDDSVCV
LGISKRNLLFQPVAELKEETDFVHRIPKEQWWLKLRPLMKILAKYKASFEVSDAGQLEPM
QPRGPEEHATI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaccacgacgtctccccgaaccccaagggctccttccgaaagttcctggagcaa
ctctccggggccggcaaagccataggcgtgctgaccagcggcggggatgcccaaggtatg
aatgctgctgtccgagctgtcgtgcgcatgggaatatacgtgggggccaaagtgtacttt
atctacgagggttaccagggcatggtggatggtggcagcaacattgtggaagccgactgg
gaaagtgtctccagcatcctgcaagtgggagggaccattattggcagtgcccgttgcaag
gacttccgttctcgggaaggccgcctgaaggctgctcataacttgcttcagctgggcatc
accaacctgtgtgtgatcggcggggacgggagtctcacgggagccaatatcttccggaag
gagtggagtgggctgctggaggagctggctcgggagggcaagatcaacacggaggaggta
cagaagcacgggtacctcaacgtggtggggatggtgggctccatcgacaacgacttctgt
ggcaccgacatgaccatcggcacggactctgccctgcaccgcatcatcgaggtggtggac
gccatcatgacgactgcccagagccaccagaggaccttcgtcctggaagtcatggggagg
cactgtgggtacctggccctggtgagtgcgttggcctgtggggccgactgggtgttcctt
ccagaatctccaccagaagaaggttggcaggaaaacatgtgcatcaaactctcagagaac
cgtgcccggaaaaaaagactgaacatcatcattgtggccgaaggagccattgacacccaa
aacaaagccatcacctctgagcaaatcaaggagctcgtggtcacacagctgggttatgac
acacgggtgaccatcctcggacacgtgcagagaggtgggacgccttcagcctttgacagg
attttggccagccgcatgggggtggaggccgtggtcgccctcctccaggccacccccgag
accccggcctgcgtggtgtcgctgagcgggaaccaggcggtgcggctgccactgatggaa
tgcgtgcagatgacccaggaagtacaaaaggcgatggatgagaggagatttaaggatgct
gtgcaactccgaggaaggagcttcgagaacaacctgaacacctacaagcggctcgccatc
aagctgccggactcccagatccctaagagcaactgcaatgtgggcatcgtgaacgtgggt
gcgcccgccgccggcatgaacgcagccgtgcgcgcggccgtgcgcgtgggcatcgccgac
ggacacaaggtgttcgctgtgtacgacggctttgagggcttcgccaaaggccaggtaaag
gaaattggctgggcagatgtcggtggctggaccggccaaggcggctccattcttggcaca
aaacgcaccctccccgggaagtacctagaggacatcgccactcagatgcgcacccatggc
atcaacgcgctcttgatcatcggtggattcgaggcctacctggggctgctggagctgtcg
gccgcacgggagaagcacaaggagttctgcgtccccatggtcatggttcccgccaccgtc
tccaacaacgtgcccggctccgatttcagcatcggggcagacaccgccctcaacaccatc
accgacatgtgtgaccgcatcaagcagtcggccagtgggaccaagcgccgcgtcttcatc
atcgagaccatggggggctactgcggctacctggccaacatgggggcgctggctgccggc
gccgatgccgcctacatcttcgaggagcctttcgacatccgggacctgcagtccaacgtg
gagcacctgacggagaagatgaagaccaccatccagaggggactcgtgctcaggaacgag
agctgcagtgagaactacaccaccgacttcatctaccagctctactcagaggagggcaag
ggggtgtttgactgcaggaagaacgtgctgggtcacatgcagcagggtggggcgccttct
ccgtttgatagaaactttggaaccaaaatttccgccagagccatgcagtggatcagcacg
aagctgaaggagccggcggggagaggaaaaagatttgtaagtgacgattccgtctgtgtg
ctgggaataagcaaaagaaacctgctcttccagcccgtggccgagctgaaggaggagacg
gacttcgtgcacaggatccccaaggagcagtggtggctgaagctgcggcccctcatgaag
atcctggccaagtacaaggccagcttcgaggtgtcggacgcgggccagctggagcccatg
cagccccgcgggcccgaggagcatgccaccatctag

DBGET integrated database retrieval system