KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071337Help
Entry
103071337         CDS       T03090                                 

Definition
(RefSeq) glutathione S-transferase 1, isoform D-like
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C GST_N_2 GST_C_3 GST_C_2 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 103071337
NCBI-ProteinID: XP_007466571
LinkDB All DBs
Position
Un
AA seq 200 aa AA seqDB search
MYKVYGDYKSGNCYKIKLMLSLLGIPFKWVDIDILKGDTQTPEFLAKNPNGKIPVLELED
GTCLWESNAILNFLADGSEFLPTEPRLRTQVLQWQFFEQYSHEPYIAVARFIQFYLNMPE
DRLEEYKTTHKGGYKALRVMERQLQATPYLVGEQFSIADIALYAYTHVAHEGGFDLAPYP
AVQAWLQRVASHPNYVAMLD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaggtttatggcgattacaaatcgggcaactgctacaagatcaaattgatgctc
agcttgttggggatcccgtttaagtgggtcgatatcgacatcctcaagggcgacacccag
acccctgagttcctggcgaagaaccccaacggcaagatcccggtgctggaactggaagac
ggcacctgcctgtgggaatccaatgcgattcttaatttcctcgccgatggcagcgagttc
ctaccgaccgaaccgcgcctgcgcacgcaagtcctgcagtggcaattcttcgagcaatac
agccacgagccctacattgcggtggcgcggttcattcagttttacctgaacatgcccgag
gatcggctggaagaatacaagaccacccacaaaggcggttacaaggccttgagggtgatg
gagcgtcagcttcaagccacgccttatttagtgggcgagcaattttccattgccgatatt
gcgttgtatgcctacacccatgtggcccatgaaggcggctttgacctggcgccgtatccg
gcggtgcaggcgtggttgcagcgcgtggccagtcatcccaactacgtggcgatgctcgac
tga

DBGET integrated database retrieval system