KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071473
Entry
103071473         CDS       T03090                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04072  Phospholipase D signaling pathway
lve04144  Endocytosis
lve04151  PI3K-Akt signaling pathway
lve04510  Focal adhesion
lve04540  Gap junction
lve04630  JAK-STAT signaling pathway
lve04810  Regulation of actin cytoskeleton
lve05163  Human cytomegalovirus infection
lve05200  Pathways in cancer
lve05206  MicroRNAs in cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05218  Melanoma
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103071473 (PDGFRA)
   04014 Ras signaling pathway
    103071473 (PDGFRA)
   04015 Rap1 signaling pathway
    103071473 (PDGFRA)
   04630 JAK-STAT signaling pathway
    103071473 (PDGFRA)
   04020 Calcium signaling pathway
    103071473 (PDGFRA)
   04072 Phospholipase D signaling pathway
    103071473 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    103071473 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103071473 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103071473 (PDGFRA)
   04540 Gap junction
    103071473 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103071473 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103071473 (PDGFRA)
   05206 MicroRNAs in cancer
    103071473 (PDGFRA)
   05230 Central carbon metabolism in cancer
    103071473 (PDGFRA)
   05231 Choline metabolism in cancer
    103071473 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    103071473 (PDGFRA)
   05218 Melanoma
    103071473 (PDGFRA)
   05215 Prostate cancer
    103071473 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103071473 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103071473 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103071473 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:lve04090]
    103071473 (PDGFRA)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103071473 (PDGFRA)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103071473 (PDGFRA)
CD molecules [BR:lve04090]
 Proteins
  103071473 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set LAT Kinase-like DUF3535
Other DBs
NCBI-GeneID: 103071473
NCBI-ProteinID: XP_007456138
UniProt: A0A340X3J6
LinkDB
Position
Un
AA seq 1089 aa
MGTSHWALLVLGCLVTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVILLSSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVVTCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEVHPRD
RSMVQGQVTFAKVEETIAVRCLAKNLLGVGSRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcgtcacagggccaagcctc
atcctctgccagctttcattaccctccatcctgcccaatgaaaacgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacacgcagttggaagaaagcgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattacttggtcatcgtg
gaggatgatgattcggccatcatcccttgtcgaacgactgatcctgagacaccagtgatt
ttactcagcagtgacggggtggtgcacgcctcctatgacagcagacaaggctttaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaaattccagacc
atcccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtctataaggcaggggaatcgattgtggtcacctgcgccgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcatcacaatg
ctggaggaaaccaaggtcccgtccatcaaattggtgtacactctgatggtccctgaggcc
acggtgaaagatagtggagattatgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtgcatgagaaagggtttattgaaatcaaacccaac
ttcagcccgttggaagctgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctgaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagcggccattatactattgtagttcaaaatgaagac
gatgtgaagagctatacttttgaactcttaactcaagttccgtcatccattctggacttg
gtcgatgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcatggacgattttggccaacaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtgcagggccaagtgacattcgccaaagtggaggaaaccattgcagtgcga
tgcctagctaagaatctcctcggggtggggagccgagagctgaagctggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgttgttggtgattgtaatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgaaattcgttggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagtcggtcccaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcttgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaacaacggtgactacatggacatgaagcaagcagacaccaca
cagtatgtccccatgctggaaaggaaagaagtttctaagtactcagacatccagagagcg
ctgtatgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggcc
gctcgcaatgtcctcctggcgcaagggaagattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcacctttctcccggtgaag
tggatggctcctgagagcatcttcgataacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtaaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgtggactccgacaatgcgtacattggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagcgcagacagtggctacatcatc
cctctgcctgacatcgaccctgttcctgaagaggaagacctgggcaaaaggaacagacac
agctcgcagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctcgtggaagacagcttcctgtaa

DBGET integrated database retrieval system