KEGG   Lipotes vexillifer (Yangtze River dolphin): 103071962
Entry
103071962         CDS       T03090                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04072  Phospholipase D signaling pathway
lve04144  Endocytosis
lve04151  PI3K-Akt signaling pathway
lve04510  Focal adhesion
lve04520  Adherens junction
lve04540  Gap junction
lve04630  JAK-STAT signaling pathway
lve04810  Regulation of actin cytoskeleton
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve05160  Hepatitis C
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103071962 (EGFR)
   04012 ErbB signaling pathway
    103071962 (EGFR)
   04014 Ras signaling pathway
    103071962 (EGFR)
   04015 Rap1 signaling pathway
    103071962 (EGFR)
   04630 JAK-STAT signaling pathway
    103071962 (EGFR)
   04066 HIF-1 signaling pathway
    103071962 (EGFR)
   04068 FoxO signaling pathway
    103071962 (EGFR)
   04020 Calcium signaling pathway
    103071962 (EGFR)
   04072 Phospholipase D signaling pathway
    103071962 (EGFR)
   04151 PI3K-Akt signaling pathway
    103071962 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103071962 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103071962 (EGFR)
   04520 Adherens junction
    103071962 (EGFR)
   04540 Gap junction
    103071962 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103071962 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103071962 (EGFR)
   04915 Estrogen signaling pathway
    103071962 (EGFR)
   04921 Oxytocin signaling pathway
    103071962 (EGFR)
   04926 Relaxin signaling pathway
    103071962 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    103071962 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103071962 (EGFR)
   05206 MicroRNAs in cancer
    103071962 (EGFR)
   05205 Proteoglycans in cancer
    103071962 (EGFR)
   05230 Central carbon metabolism in cancer
    103071962 (EGFR)
   05231 Choline metabolism in cancer
    103071962 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103071962 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103071962 (EGFR)
   05212 Pancreatic cancer
    103071962 (EGFR)
   05225 Hepatocellular carcinoma
    103071962 (EGFR)
   05226 Gastric cancer
    103071962 (EGFR)
   05214 Glioma
    103071962 (EGFR)
   05218 Melanoma
    103071962 (EGFR)
   05219 Bladder cancer
    103071962 (EGFR)
   05215 Prostate cancer
    103071962 (EGFR)
   05213 Endometrial cancer
    103071962 (EGFR)
   05224 Breast cancer
    103071962 (EGFR)
   05223 Non-small cell lung cancer
    103071962 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103071962 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103071962 (EGFR)
   05171 Coronavirus disease - COVID-19
    103071962 (EGFR)
   05163 Human cytomegalovirus infection
    103071962 (EGFR)
   05165 Human papillomavirus infection
    103071962 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103071962 (EGFR)
   01522 Endocrine resistance
    103071962 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103071962 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103071962 (EGFR)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103071962 (EGFR)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103071962 (EGFR)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   103071962 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   103071962 (EGFR)
  Exosomal proteins of bladder cancer cells
   103071962 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Borrelia_P83 Kdo
Other DBs
NCBI-GeneID: 103071962
NCBI-ProteinID: XP_007463741
UniProt: A0A340XQY3
LinkDB
Position
Un
AA seq 1209 aa
MRRSEAGRAVLLALLAAHFQASPALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSSYNLSFLKTIQEVAGYVLIALNTVEKIPLEKLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPMRNLQEILQGAVRFSNNPVLCNMDTVQWRDIVNTDFLSNMSTEF
QSQLSRCPKCDPVCLNGSCWGAGKENCQKLTKVICAQQCSGRCRGRSPSDCCHSQCAAGC
TGPRESDCLVCRRFRDGATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVRKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCGKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFKGDSFTRTPPLDPKELDILKTVKEITGFLLIQAWPANRTGLHAF
ENLEIIRGRTKQHGQFSLAVVGLDIMSLGLRSLKEISDGDVIISGNRKLCYADTINWKKL
FGTSSQKTKIINNRSEKECKAMGHVCNPLCSSEGCWGPKPKDCVSCRNFSRGKECVEKCN
VLKGEPREFVENSECVQCHPECLPQAMNVTCTGHGPGSCVKCAHNIDGPHCVKTCPAGVT
GENSTLIWKFADANHVCHLCHPSCTYGCAGPGLEGCAVSGPRIPSIATGIVGALLLALVL
ALGVGLFLRRRRIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETELKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQHLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSSFYRALVDEEDMQDVVDADEYLIPQ
QGFFHSPATSRTPLLSSLSATSNTPTVACGDRNGQSYPLPEDSFLQRYSSDPTGTLTEDS
IDDAFLPAPEYINQSIPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNSHSNAVDSPEYLNT
TRPACTNGVLDGPALWAQKGGHQISLDNPDYQQAFFPKEAKSNGIFKGSAAENAEYLRVA
PAGSDLTGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgacgctccgaagcgggccgcgccgtgctcctggcgctgctggccgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ttgggcacttttgaagaccactttctgagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaataacctacatgcaaagtagttacaacctttctttcctgaag
accatccaggaggttgctggctatgtactcattgccctcaacacagtggagaagattcct
ttggaaaagctgcagatcatcagaggaaatgtgctctatgaaaacacccatgccttagcg
gtcttatccaactacggtgcaaataaaacgggactgagggagttgcccatgagaaactta
caggagatcctgcaaggcgccgtgcgattcagcaacaaccctgtcctctgcaacatggac
accgtccagtggagggacatcgtcaacaccgactttctaagcaatatgtcaactgaattt
cagagccagctgagcagatgcccaaagtgtgatccagtctgtcttaatggaagctgctgg
ggtgcggggaaggagaactgccagaaactgaccaaagtcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccacagccagtgtgccgccggctgc
acagggccacgggagagtgactgcctggtctgccgcaggttccgggacggtgccacgtgc
aaggacacatgcccgccactcatgctgtacgaccccaccacctacgagatgaaagtcaac
ccactggggaagtatagcttcggcgccacctgtgtcaggaagtgcccccgtaactacgtg
gtgacggaccacggctcgtgcgtccgcgcctgcagctctgacagccaggaggtggaggag
gacggcgtccgcaagtgtaaaaagtgcgacggaccttgtggcaaagtttgtaacggaata
ggaattggtgagtttaaagatacactttccataaatgctacaaatattaaacacttcaga
aattgcacctcgatcagtggagaccttcatatcctgccagtagcatttaagggtgattcc
ttcacacgtactccacctctggacccaaaggaactggacattctaaaaactgtaaaggaa
ataacagggtttttgctgattcaggcctggcctgcaaacaggactggcctccatgctttt
gagaacctggaaatcatacgtggcaggacgaagcaacatggtcagttttctctggcggtt
gttggcctggatataatgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcatttcaggaaaccgaaagttgtgctacgcagatacaataaactggaaaaaactc
tttgggacctcaagtcagaaaaccaaaattataaacaacaggagtgaaaaagagtgcaag
gccatgggccacgtctgtaacccgctgtgctcgtcagagggctgctggggcccgaaaccc
aaagactgcgtgtcctgccgaaacttcagtcgtggcaaggagtgtgtggagaagtgcaac
gttctaaagggagagcccagggagttcgttgagaactccgagtgcgtgcagtgccatccg
gaatgcctgccccaggccatgaacgtgacctgcacgggacacggaccaggcagctgtgta
aagtgtgcccacaacatcgacggccctcactgcgtcaagacctgccctgctggagtcaca
ggagaaaacagcaccctgatctggaagtttgcagatgccaatcacgtgtgtcacctgtgc
caccccagctgcacctacggctgtgctgggccaggtcttgaaggctgtgcagtgagtggg
cccaggattccgtccatcgccaccgggatcgtgggcgccctgctgctggccctggtgctg
gccctgggggtcggcctctttctgcgcaggcgccgcatcgtccgcaagcgcacgctgcgc
cggctgctgcaggagcgcgagcttgtcgagcctctgacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggagacggaattaaaaaaggtcaaggtgctgggctcc
ggagcattcggcacggtgtacaagggactgtggatcccagaaggcgagaaggttaaaatt
cctgtggctatcaaggaattaagagaagccacatctccaaaagccaacaaggaaattctt
gatgaagcctacgtgatggccagtgtggacaatcctcacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtgcagctcatcacgcagctcatgcccttcggctgcctgctggac
tatgtccgcgagcacaaggacaacatcggctcccagcacctgctcaactggtgcgtgcag
atcgcaaagggcatgaactacctggaagaccggcgcctggtgcaccgagacctggcggcc
aggaatgtgctggtgaagacgccgcagcacgtcaagatcacggatttcgggctggccaaa
ctgctgggcgctgaggagaaagaataccatgcggaggggggcaaagtgcctatcaagtgg
atggctttggaatcaattttacaccgaatttatacccaccagagtgacgtctggagctac
ggagtcaccgtttgggagttgatgacctttgggtccaagccttacgacgggatccccgcg
agtgagatctcaaccgtcctggagaagggagaacgcctgcctcagccgcccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgattgatgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaagatggcccgagacccccagcgctaccttgtc
atccagggggacgagaggatgcacttgccaagccccacggactccagcttctaccgcgcc
ctggtggatgaagaggacatgcaggatgttgtggatgcggacgagtacctcatcccccag
cagggcttcttccacagccccgccacctcccggacgcccctcctcagttctctgagcgcc
accagcaacacgcccactgtggcttgcggtgatagaaacgggcagagctatcccctccct
gaagatagcttcttgcagcggtacagctccgaccccactggcaccttgaccgaggacagc
atagatgacgccttccttccagcgcccgaatacataaaccagtctattcccaaaaggccc
gcgggctctgtccagaaccccgtctatcacaatcagcctctaaacccggctccaggcaga
gaccctcactaccagaattcccacagcaatgccgtggacagccctgagtatctcaacacc
acccgtcccgcctgcaccaacggtgtgctcgacggccctgccctctgggcacagaaaggc
ggtcaccaaattagcctggacaaccctgactaccagcaggccttctttcccaaggaagcc
aagtcaaatggcatctttaagggttctgccgctgaaaatgcagaatacctaagggtagca
ccagcgggcagcgaccttaccggggcctga

DBGET integrated database retrieval system