KEGG   Lipotes vexillifer (Yangtze River dolphin): 103072342
Entry
103072342         CDS       T03090                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve04012  ErbB signaling pathway
lve04015  Rap1 signaling pathway
lve04062  Chemokine signaling pathway
lve04137  Mitophagy - animal
lve04144  Endocytosis
lve04360  Axon guidance
lve04370  VEGF signaling pathway
lve04510  Focal adhesion
lve04520  Adherens junction
lve04530  Tight junction
lve04540  Gap junction
lve04611  Platelet activation
lve04625  C-type lectin receptor signaling pathway
lve04727  GABAergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04810  Regulation of actin cytoskeleton
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve05100  Bacterial invasion of epithelial cells
lve05135  Yersinia infection
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05168  Herpes simplex virus 1 infection
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05219  Bladder cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103072342 (SRC)
   04015 Rap1 signaling pathway
    103072342 (SRC)
   04370 VEGF signaling pathway
    103072342 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103072342 (SRC)
   04137 Mitophagy - animal
    103072342 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103072342 (SRC)
   04520 Adherens junction
    103072342 (SRC)
   04530 Tight junction
    103072342 (SRC)
   04540 Gap junction
    103072342 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103072342 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103072342 (SRC)
   04625 C-type lectin receptor signaling pathway
    103072342 (SRC)
   04062 Chemokine signaling pathway
    103072342 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103072342 (SRC)
   04915 Estrogen signaling pathway
    103072342 (SRC)
   04917 Prolactin signaling pathway
    103072342 (SRC)
   04921 Oxytocin signaling pathway
    103072342 (SRC)
   04926 Relaxin signaling pathway
    103072342 (SRC)
   04919 Thyroid hormone signaling pathway
    103072342 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    103072342 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103072342 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    103072342 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103072342 (SRC)
   05203 Viral carcinogenesis
    103072342 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    103072342 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103072342 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103072342 (SRC)
   05152 Tuberculosis
    103072342 (SRC)
   05100 Bacterial invasion of epithelial cells
    103072342 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103072342 (SRC)
   05168 Herpes simplex virus 1 infection
    103072342 (SRC)
   05163 Human cytomegalovirus infection
    103072342 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103072342 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103072342 (SRC)
   01522 Endocrine resistance
    103072342 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103072342 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103072342 (SRC)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103072342 (SRC)
Protein kinases [BR:lve01001]
 Non-receptor tyrosine kinases
  SRC family
   103072342 (SRC)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103072342 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    103072342 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103072342 (SRC)
  Macropinocytosis
   Kinases
    103072342 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 103072342
NCBI-ProteinID: XP_007447788
UniProt: A0A340WDY6
LinkDB
Position
Un
AA seq 548 aa
MGSNKSKPKDASQRRRSLEPADNTHGGCGGGGGGGGGGGGVGAFPTSQTPSKPASADGHR
GPSTAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKG
ERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNA
ENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQ
LVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGT
WNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGS
LLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGESLVCKVADF
GLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPG
MVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEP
QYQPGENL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggaacct
gctgataacacccatggcggctgtggcggcggcggtggtggcggcggcggcggcggcggc
gtgggggccttccccacctcacagacccccagcaagccggcctccgctgatggccaccgg
ggccccagcacggccttcgcccctgcagccgccgagcccaagctgttcggaggtttcaat
tcctccgacacagtcacctccccgcagagggcggggcccctggctggcggagtgaccacc
tttgtggccctctatgactatgagtcgcggacagagactgacctgtctttcaagaaaggg
gagcggctccagattgtcaacaacacagagggagactggtggctggcccactcactcagc
acaggacagacgggctatatccccagcaactatgtcgcgccctccgactccatccaggcc
gaggagtggtactttggcaagatcaccagacgggagtcagagcggttactgctcaatgcg
gagaacccaagaggtaccttcctagtgcgagaaagcgagaccacgaaaggcgcctactgc
ctctcagtgtctgacttcgacaacgccaagggcctcaacgtgaaacactacaagatccgc
aagctggacagcggcggcttctacatcacctcccgcacccagttcaacagcctgcagcag
ctcgtggcctactactccaaacacgctgacggcctgtgccaccgcctcaccactgtgtgc
cccacgtccaagccacagactcagggcctggccaaggacgcctgggagatcccccgggag
tcgctgcggctggaggtcaagctgggccagggctgcttcggagaggtgtggatggggacc
tggaatggcaccaccagggtggccatcaaaactctgaagcccggcacgatgtctccggag
gccttccttcaggaggcccaggtcatgaagaaactgaggcatgagaagctggtgcagctg
tacgcggtggtgtctgaggagcccatctacatcgtcacggagtacatgagcaaggggagt
ttgctggactttctcaagggggagacgggcaagtacctgcggctgcctcagctggtggac
atggctgctcagatcgcttcaggcatggcgtacgtggagcggatgaactatgtccaccga
gacctccgtgctgccaacatcctggttggagaaagcctcgtgtgcaaagtggctgacttt
gggctggctcggctcatcgaagacaatgagtacacagcccggcaaggtgccaaattcccc
atcaagtggacggctccagaagctgccctctatggccggttcaccatcaagtcagatgtg
tggtcctttgggatcctgctgacagagctcacgacaaagggacgggtgccctaccccggg
atggtgaaccgcgaggtgctggaccaggtggagaggggctaccggatgccctgcccgccc
gagtgtcccgagtctctgcatgacctcatgtgccagtgctggcggaaggacccagaggag
cggcccaccttcgagtacctgcaggccttcctggaggactatttcacgtccaccgagccc
cagtaccagcccggagagaacctatag

DBGET integrated database retrieval system