KEGG   Lipotes vexillifer (Yangtze River dolphin): 103072903Help
Entry
103072903         CDS       T03090                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04066  HIF-1 signaling pathway
lve04114  Oocyte meiosis
lve04217  Necroptosis
lve04261  Adrenergic signaling in cardiomyocytes
lve04310  Wnt signaling pathway
lve04360  Axon guidance
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04934  Cushing syndrome
lve04971  Gastric acid secretion
lve05031  Amphetamine addiction
lve05152  Tuberculosis
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05214  Glioma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103072903 (CAMK2G)
   04310 Wnt signaling pathway
    103072903 (CAMK2G)
   04066 HIF-1 signaling pathway
    103072903 (CAMK2G)
   04020 Calcium signaling pathway
    103072903 (CAMK2G)
   04024 cAMP signaling pathway
    103072903 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103072903 (CAMK2G)
   04217 Necroptosis
    103072903 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103072903 (CAMK2G)
   04922 Glucagon signaling pathway
    103072903 (CAMK2G)
   04912 GnRH signaling pathway
    103072903 (CAMK2G)
   04921 Oxytocin signaling pathway
    103072903 (CAMK2G)
   04916 Melanogenesis
    103072903 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    103072903 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103072903 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    103072903 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    103072903 (CAMK2G)
   04728 Dopaminergic synapse
    103072903 (CAMK2G)
   04720 Long-term potentiation
    103072903 (CAMK2G)
   04722 Neurotrophin signaling pathway
    103072903 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    103072903 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    103072903 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    103072903 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103072903 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103072903 (CAMK2G)
   05205 Proteoglycans in cancer
    103072903 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    103072903 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    103072903 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103072903 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103072903 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103072903 (CAMK2G)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103072903 (CAMK2G)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103072903 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 103072903
NCBI-ProteinID: XP_007467582
UniProt: A0A340Y5E7
LinkDB All DBs
Position
Un
AA seq 672 aa AA seqDB search
MEAQLPPFPPAASGGLVAPSSLPRSALRALQQLPGLLHPALPRGLQPLERSWAPPAPPLL
QPSGAPHPDPTCSLTPSHSVQELIQHPVLCPTRLALRTLPGPAAPTPLRGPGSRAPQPQH
PPPLRTEQAAAAAPAPPPPPAAASPATAAPALLAPLDVSRAGEWKLPGAFSVVRRCVKKT
STQEYAAKIINTKKLSARDHQKLEREARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTG
GELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKL
ADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFW
DEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQR
STVASMMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAG
QAAKSLLNKKSDGGVKKRKSSSSVHLMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVR
KQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKN
SKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVH
YHCSGAPAAPLQ
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccaactcccacctttcccgccagccgcctccgggggcctcgtcgcccccagc
tccctgccccgcagcgccctccgcgccctgcagcagctgcccgggctgctgcatcccgcg
ctgccgcggggactgcagcccctggagcgctcctgggcgcccccagccccgcccctcctg
cagccttcaggcgccccccatcccgaccccacctgctcgctgaccccttcccactcagtt
caggagctcattcagcatcccgtcctatgtcccacgcgcctggcactcaggaccctcccc
ggccctgcagctccaaccccgctgcgtggtcccgggagccgcgcgccgcagccgcagcat
ccccctcccctccgcactgagcaggccgctgcagcagccccagcccccccacccccaccc
gcggcggcgagcccggccactgcagcccccgccctgctcgcccccctagatgtttccaga
gctggagagtggaagctcccgggtgctttctctgtggtccgcaggtgtgtgaagaaaacc
tccacgcaggagtatgcagcaaaaatcatcaataccaagaaattatctgcccgggatcac
cagaaactagaacgtgaggcccggatatgccgacttttgaagcatccaaacattgtacgc
ctccatgacagtatttctgaagaagggtttcactacctcgtgtttgaccttgttactggt
ggggagctgtttgaagacattgtggccagagaatactacagtgaagctgatgccagccac
tgtatacatcagattctggagagtgttaaccacatccaccagcatgacattgtccaccgg
gacctgaagcctgagaacctcctgctggcgagtaaatgcaagggtgctgcagtcaagctg
gctgattttggcctagccatcgaagtacagggagagcaacaggcttggtttggttttgct
ggcaccccaggttacttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtg
gatatctgggcctgcggggtcatcctgtatatcctcctggtgggctaccctcccttctgg
gatgaggatcagcacaagctgtaccagcagatcaaggctggagcctatgatttcccatca
ccagagtgggacacggtgactcctgaagccaagaacttgatcaaccagatgctgaccata
aaccctgcaaagcgtatcacagctgaccaggctctcaagcatccatgggtctgtcaacgg
tccacagtggcatctatgatgcatcgtcaagagaccgtggagtgcctacgcaagttcaat
gcccggagaaaactgaagggtgccatcctcacgaccatgcttgtctccaggaacttttca
gttggcaggcagagctccgcccccgcctcgcctgccgcgagcgccgccggcctggccggg
caagctgccaaaagcctattgaacaagaagtcggatggcggtgtcaagaaaaggaagtcg
agttccagcgtgcacctaatggagccacaaaccactgtggtccacaatgctacagatggg
atcaagggctccacagagagctgcaacaccaccacagaagatgaggacctcaaagtgcga
aaacaggagatcattaagatcacagaacaactaattgaggccatcaacaatggggacttt
gaggcctacacgaagatttgtgatccaggcctcacttcctttgagcctgaggccctcggt
aacctcgtggaagggatggatttccataagttttactttgagaatctcctgtctaagaac
agcaagcccatccacaccaccatcctgaacccgcacgtccatgtgattggagaggacgcg
gcttgcatcgcctacatccgccttacccagtacatcgatgggcagggccggcctcgcacc
agccagtcagaggagacccgggtctggcaccgccgggatggcaagtggctcaatgtccac
tatcactgttcaggggcccctgccgcaccgctgcagtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075213Help
Entry
103075213         CDS       T03090                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04066  HIF-1 signaling pathway
lve04114  Oocyte meiosis
lve04217  Necroptosis
lve04261  Adrenergic signaling in cardiomyocytes
lve04310  Wnt signaling pathway
lve04360  Axon guidance
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04934  Cushing syndrome
lve04971  Gastric acid secretion
lve05031  Amphetamine addiction
lve05152  Tuberculosis
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05214  Glioma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103075213 (CAMK2B)
   04310 Wnt signaling pathway
    103075213 (CAMK2B)
   04066 HIF-1 signaling pathway
    103075213 (CAMK2B)
   04020 Calcium signaling pathway
    103075213 (CAMK2B)
   04024 cAMP signaling pathway
    103075213 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103075213 (CAMK2B)
   04217 Necroptosis
    103075213 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103075213 (CAMK2B)
   04922 Glucagon signaling pathway
    103075213 (CAMK2B)
   04912 GnRH signaling pathway
    103075213 (CAMK2B)
   04921 Oxytocin signaling pathway
    103075213 (CAMK2B)
   04916 Melanogenesis
    103075213 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    103075213 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103075213 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    103075213 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    103075213 (CAMK2B)
   04728 Dopaminergic synapse
    103075213 (CAMK2B)
   04720 Long-term potentiation
    103075213 (CAMK2B)
   04722 Neurotrophin signaling pathway
    103075213 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    103075213 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    103075213 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    103075213 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103075213 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103075213 (CAMK2B)
   05205 Proteoglycans in cancer
    103075213 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    103075213 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    103075213 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103075213 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103075213 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103075213 (CAMK2B)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103075213 (CAMK2B)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103075213 (CAMK2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2 APH Pkinase_fungal Kdo SnoaL_4
Motif
Other DBs
NCBI-GeneID: 103075213
NCBI-ProteinID: XP_007447058
UniProt: A0A340WBZ0
LinkDB All DBs
Position
Un
AA seq 542 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGATMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSTHTTIEDEDTKARKQEIIKITEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
LQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacttgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctatctgccagagatcaccagaagctggagaga
gaggctcgaatctgccgtcttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggaaggcttccactacctggtcttcgatctggtcactggtggggagctctttgag
gacatcgtggcgagagagtactacagtgaggcagatgccagtcactgcatccagcagatc
ctggaggcggttctccattgccaccaaatgggggttgtccacagggacctcaagcccgag
aacctgctcctggccagcaagtgcaaaggggccgcagtgaagctggcggacttcggcctg
gctatcgaggtgcagggggaccagcaggcctggtttgggttcgctggcacgccaggctac
ctgtccccagaggtgctgcgcaaggaggcgtacggcaagccggtggacatctgggcgtgc
ggggtgatcctgtacatcctgctggtgggctacccgcccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggccggggcctacgacttcccatctccggagtgggacacg
gtcactcctgaagccaaaaacctcatcaaccagatgttgaccatcaaccctgccaagcgc
atcacggcgcacgaggcgctgaagcacccgtgggtctgccaacgctccactgtggcctcc
atgatgcacaggcaggagaccgtggagtgcctgaaaaagttcaatgcccggcggaagctc
aagggcgcgatcctcaccaccatgctggccacgcggaatttctcagtgggcagacagacc
accgctccagccacaatgtccaccgcggcctccggcgccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagctgccaccagccccaaggggacacttcctccagctgccctggaacctcaa
accaccgtcattcataacccagtggacgggatcaaggagtcatctgacagcacccacacc
accatagaggacgaagacacaaaagcgcggaagcaggagatcatcaagatcacggagcag
ctcatcgaggccgtcaacaacggtgactttgaggcctatgcgaaaatctgcgacccaggc
ctgacctcgtttgagcccgaagccctgggcaacctggttgaagggatggacttccacaga
ttctacttcgagaacttgctcgccaagaacagcaagccgatccacacgacgatcctgaac
ccgcacgtgcacgtcatcggcgaggacgccgcgtgcattgcttacatccgcctcacgcaa
tacatcgacgggcagggccggccccgcaccagccagtccgaggagacccgcgtgtggcac
cgccgagacggcaagtggcagaacgtgcatttccactgctcgggggcgcccgtggccccg
ctgcagtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103081366Help
Entry
103081366         CDS       T03090                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04066  HIF-1 signaling pathway
lve04114  Oocyte meiosis
lve04217  Necroptosis
lve04261  Adrenergic signaling in cardiomyocytes
lve04310  Wnt signaling pathway
lve04360  Axon guidance
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04934  Cushing syndrome
lve04971  Gastric acid secretion
lve05031  Amphetamine addiction
lve05152  Tuberculosis
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05214  Glioma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103081366 (CAMK2A)
   04310 Wnt signaling pathway
    103081366 (CAMK2A)
   04066 HIF-1 signaling pathway
    103081366 (CAMK2A)
   04020 Calcium signaling pathway
    103081366 (CAMK2A)
   04024 cAMP signaling pathway
    103081366 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103081366 (CAMK2A)
   04217 Necroptosis
    103081366 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103081366 (CAMK2A)
   04922 Glucagon signaling pathway
    103081366 (CAMK2A)
   04912 GnRH signaling pathway
    103081366 (CAMK2A)
   04921 Oxytocin signaling pathway
    103081366 (CAMK2A)
   04916 Melanogenesis
    103081366 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    103081366 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103081366 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    103081366 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    103081366 (CAMK2A)
   04728 Dopaminergic synapse
    103081366 (CAMK2A)
   04720 Long-term potentiation
    103081366 (CAMK2A)
   04722 Neurotrophin signaling pathway
    103081366 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    103081366 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    103081366 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    103081366 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103081366 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103081366 (CAMK2A)
   05205 Proteoglycans in cancer
    103081366 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    103081366 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    103081366 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103081366 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103081366 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103081366 (CAMK2A)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103081366 (CAMK2A)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103081366 (CAMK2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Kdo SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 103081366
NCBI-ProteinID: XP_007448115
UniProt: A0A340WM67
LinkDB All DBs
Position
Un
AA seq 489 aa AA seqDB search
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKNDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDEAACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIIHFHR
SGAPSVLPQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacagaagagtaccagctcttcgaggaactggga
aagggagccttctcagtggtgcgcaggtgtgtgaaggtgctggctggccaggaatatgct
gctaagatcatcaacactaagaagctctcggccagagaccaccagaagctggagcgtgaa
gcccgcatctgccgcctgctgaagcaccccaacattgtccggctccacgacagcatctcc
gaggagggacaccattacctgatctttgacctcgtcaccggcggggagctgtttgaagac
atcgtggcccgggagtattacagtgaggcagatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtacaccgggacttgaagccggagaat
ctgttgctggcctccaagctcaagggcgccgcagtgaagctggcggactttggcctggcc
atagaggtggagggggaacagcaggcatggtttgggttcgcagggacacccggatacctc
tccccagaagtgctgcggaaggacccgtacgggaagcctgtggatctgtgggcctgtggg
gtcatcctgtacatcctgctggttgggtatcccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagctggcgcctatgatttcccatcaccagaatgggacaccgtc
accccggaagccaaggatctgatcaataaaatgctgaccatcaacccatccaaacgcatc
acggccgccgaggccctcaagcacccctggatctcgcaccggtccaccgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggagaaaactcaag
ggagccatcctcaccactatgctggccaccaggaacttctctggcgggaagagtggagga
aacaagaagaatgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcagagagcaccaacaccaccattgaggatgaagacaccaaagtgcggaaacaagaa
attataaaagtgacagaacagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgtgaccccgggatgacagccttcgaacccgaggccctagggaacctggtc
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagcct
gtgcacaccaccatcctgaatccccacattcacctgatgggtgacgaggcggcctgcatc
gcctacatccgcatcacgcagtacctggatgcgggcggcatcccccgcacggcccagtcg
gaagagacccgcgtctggcaccgccgggatggcaaatggcagatcatccacttccacaga
tcgggggcgccctccgtcctgccccagtaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103088458Help
Entry
103088458         CDS       T03090                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04066  HIF-1 signaling pathway
lve04114  Oocyte meiosis
lve04217  Necroptosis
lve04261  Adrenergic signaling in cardiomyocytes
lve04310  Wnt signaling pathway
lve04360  Axon guidance
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04934  Cushing syndrome
lve04971  Gastric acid secretion
lve05031  Amphetamine addiction
lve05152  Tuberculosis
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05214  Glioma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103088458 (CAMK2D)
   04310 Wnt signaling pathway
    103088458 (CAMK2D)
   04066 HIF-1 signaling pathway
    103088458 (CAMK2D)
   04020 Calcium signaling pathway
    103088458 (CAMK2D)
   04024 cAMP signaling pathway
    103088458 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103088458 (CAMK2D)
   04217 Necroptosis
    103088458 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103088458 (CAMK2D)
   04922 Glucagon signaling pathway
    103088458 (CAMK2D)
   04912 GnRH signaling pathway
    103088458 (CAMK2D)
   04921 Oxytocin signaling pathway
    103088458 (CAMK2D)
   04916 Melanogenesis
    103088458 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    103088458 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103088458 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    103088458 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    103088458 (CAMK2D)
   04728 Dopaminergic synapse
    103088458 (CAMK2D)
   04720 Long-term potentiation
    103088458 (CAMK2D)
   04722 Neurotrophin signaling pathway
    103088458 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    103088458 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    103088458 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    103088458 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103088458 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103088458 (CAMK2D)
   05205 Proteoglycans in cancer
    103088458 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    103088458 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    103088458 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103088458 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103088458 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103088458 (CAMK2D)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     103088458 (CAMK2D)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   103088458 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_4 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 103088458
NCBI-ProteinID: XP_007454863
UniProt: A0A340WZR3
LinkDB All DBs
Position
Un
AA seq 536 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISXXXEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCI
QQILEAVLHCHQMGVVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGT
PGYLSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPE
WDTVTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNAR
RKLKGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHN
PDGNKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPE
ALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGM
PKTMQSEETRVWHRRDGKWQNVHFHRSGSRTVPIKPSCIPNGKENFSGSTSLWQNI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgactacaacctgtaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaagg
gaagctagaatctgccgtcttttgaagcaccccaatattgtgcgacttcacgacagcata
tcnnnnnnnnnngaagagggcttccattacttggtgtttgatttagttactggaggtgaa
ctgtttgaagacatagtggcaagagaatattacagtgaagccgacgccagtcattgcatt
cagcagatcctggaggctgtgctacactgccatcagatgggcgtagtccatcgggacctg
aagcctgagaatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagac
tttggcttagccatagaagttcaaggagaccagcaggcgtggtttggttttgctggcaca
cctggatatctttctccagaagttttacgcaaagatccttatggaaagccagtggatatg
tgggcgtgtggggtcattctctacattctactggttggatatccacccttctgggatgaa
gaccagcacagactctatcagcagatcaaggctggagcttatgattttccatcaccggag
tgggacacagtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccct
gccaagcgtatcacagcctcggaggcactgaaacacccatggatctgtcaacgttctact
gttgcttccatgatgcacagacaggagactgttgactgcttgaagaaattcaatgccaga
agaaaactgaagggtgccatcttgacaactatgctggctacgaggaatttttcagcagcc
aagagtttgttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaacc
agccccaaagaaaatattcctaccccggcgctggagccccaaactactgtaatccacaac
cctgatggaaacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtg
aaagcacgaaagcaagagattatcaaagttactgaacaactcatcgaagctatcaacaat
ggggactttgaagcttacacgaaaatctgtgacccaggccttactgcttttgaacctgaa
gctttgggtaatttagtggaagggatggactttcatcgattctactttgagaatgctttg
tccaaaagcaataaaccaatccacactattatcctgaacccccatgtacatctggtaggc
gatgatgctgcctgcatagcatacattaggctcacacagtacatggatggcagcggaatg
cctaaaacaatgcagtcagaagagacacgtgtgtggcaccgccgggatggaaagtggcag
aatgttcattttcatcgctcggggtcgcgaacagtacccatcaagccatcttgtattcca
aatgggaaagaaaacttctcaggaagcacctctttgtggcaaaacatctaa

DBGET integrated database retrieval system