KEGG   Lipotes vexillifer (Yangtze River dolphin): 103072990
Entry
103072990         CDS       T03090                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones, alpha polypeptide
  KO
K08522  glycoprotein hormones alpha chain
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04024  cAMP signaling pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04917  Prolactin signaling pathway
lve04918  Thyroid hormone synthesis
lve04923  Regulation of lipolysis in adipocytes
lve04929  GnRH secretion
lve05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103072990 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103072990 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    103072990 (CGA)
   04929 GnRH secretion
    103072990 (CGA)
   04912 GnRH signaling pathway
    103072990 (CGA)
   04913 Ovarian steroidogenesis
    103072990 (CGA)
   04917 Prolactin signaling pathway
    103072990 (CGA)
   04918 Thyroid hormone synthesis
    103072990 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103072990 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 103072990
NCBI-ProteinID: XP_007467377
UniProt: A0A340Y4R3
LinkDB
Position
Un
AA seq 120 aa
MDYYRKYAAVILATLSVFLQILYSFPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNARVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactacagaaaatatgcagctgtcattctggccacattgtctgtgtttctgcaa
attctctattcctttcctgatggagagtttacaatgcagggctgcccagaatgcaagcta
aaggaaaacaaatacttctccaagctgggtgccccaatctatcaatgcatgggctgctgc
ttctccagagcataccccactccagcgaggtccaagaagacaatgttggtcccaaagaac
atcacctcagaagccacatgctgtgtggccaaagcatttaccaaggctacagtaatggga
aatgccagagtggagaatcacactgagtgccactgcagtacttgttattatcacaaatct
taa

DBGET integrated database retrieval system