KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073028
Entry
103073028         CDS       T03090                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04066  HIF-1 signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04360  Axon guidance
lve04370  VEGF signaling pathway
lve04510  Focal adhesion
lve04540  Gap junction
lve04650  Natural killer cell mediated cytotoxicity
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04670  Leukocyte transendothelial migration
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve04960  Aldosterone-regulated sodium reabsorption
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05214  Glioma
lve05223  Non-small cell lung cancer
lve05225  Hepatocellular carcinoma
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103073028 (PRKCA)
   04012 ErbB signaling pathway
    103073028 (PRKCA)
   04014 Ras signaling pathway
    103073028 (PRKCA)
   04015 Rap1 signaling pathway
    103073028 (PRKCA)
   04310 Wnt signaling pathway
    103073028 (PRKCA)
   04370 VEGF signaling pathway
    103073028 (PRKCA)
   04066 HIF-1 signaling pathway
    103073028 (PRKCA)
   04020 Calcium signaling pathway
    103073028 (PRKCA)
   04070 Phosphatidylinositol signaling system
    103073028 (PRKCA)
   04072 Phospholipase D signaling pathway
    103073028 (PRKCA)
   04071 Sphingolipid signaling pathway
    103073028 (PRKCA)
   04151 PI3K-Akt signaling pathway
    103073028 (PRKCA)
   04150 mTOR signaling pathway
    103073028 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103073028 (PRKCA)
   04540 Gap junction
    103073028 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103073028 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    103073028 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    103073028 (PRKCA)
   04670 Leukocyte transendothelial migration
    103073028 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    103073028 (PRKCA)
   04929 GnRH secretion
    103073028 (PRKCA)
   04912 GnRH signaling pathway
    103073028 (PRKCA)
   04921 Oxytocin signaling pathway
    103073028 (PRKCA)
   04926 Relaxin signaling pathway
    103073028 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    103073028 (PRKCA)
   04918 Thyroid hormone synthesis
    103073028 (PRKCA)
   04919 Thyroid hormone signaling pathway
    103073028 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    103073028 (PRKCA)
   04916 Melanogenesis
    103073028 (PRKCA)
   04925 Aldosterone synthesis and secretion
    103073028 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103073028 (PRKCA)
   04270 Vascular smooth muscle contraction
    103073028 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    103073028 (PRKCA)
   04971 Gastric acid secretion
    103073028 (PRKCA)
   04972 Pancreatic secretion
    103073028 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103073028 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103073028 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103073028 (PRKCA)
   04727 GABAergic synapse
    103073028 (PRKCA)
   04725 Cholinergic synapse
    103073028 (PRKCA)
   04728 Dopaminergic synapse
    103073028 (PRKCA)
   04726 Serotonergic synapse
    103073028 (PRKCA)
   04720 Long-term potentiation
    103073028 (PRKCA)
   04730 Long-term depression
    103073028 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    103073028 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103073028 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    103073028 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103073028 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103073028 (PRKCA)
   05206 MicroRNAs in cancer
    103073028 (PRKCA)
   05205 Proteoglycans in cancer
    103073028 (PRKCA)
   05231 Choline metabolism in cancer
    103073028 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103073028 (PRKCA)
   05214 Glioma
    103073028 (PRKCA)
   05223 Non-small cell lung cancer
    103073028 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103073028 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    103073028 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    103073028 (PRKCA)
   05032 Morphine addiction
    103073028 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103073028 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103073028 (PRKCA)
   05161 Hepatitis B
    103073028 (PRKCA)
   05171 Coronavirus disease - COVID-19
    103073028 (PRKCA)
   05164 Influenza A
    103073028 (PRKCA)
   05163 Human cytomegalovirus infection
    103073028 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103073028 (PRKCA)
   05143 African trypanosomiasis
    103073028 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103073028 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103073028 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103073028 (PRKCA)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103073028 (PRKCA)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103073028 (PRKCA)
Membrane trafficking [BR:lve04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103073028 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2
Other DBs
NCBI-GeneID: 103073028
NCBI-ProteinID: XP_007455338
UniProt: A0A340X141
LinkDB
Position
Un
AA seq 687 aa
MADVFSANDSAAPQDVANRFARKGALRQKNVHEVKDHRFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTEEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNAE
LRQKFEKAKLGPAGNKVISPEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGT
EELYAVKILKKDVVIQDDDVECTLVEKRVLALPDKPPFLTQLHSCFQTVDRLYFVMEYVN
GGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIAD
FGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGE
DEDELFQSIMEHNVSYPKSLSREAVSICKGLMTKHPGKRLGCGPEGERDVREHTFFRRID
WEKLENREVQPPFKPKVTSCTEMHCAEAVSRPTCGKGAENFDKFFTRGQPVLTPPDQLVI
ANIDQSDFEGFSYVNPQFVHPILQSTV
NT seq 2064 nt   +upstreamnt  +downstreamnt
atggctgacgtcttctcggccaacgactcggcggcgcctcaggacgtggccaaccgcttc
gctcgcaaaggggcgctgagacagaagaacgtgcacgaggtgaaggaccaccgcttcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgactttatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataaaggacctgacactgatgaccccagaagc
aagcacaaattcaagatccacacctacggaagccccaccttctgcgatcactgtgggtcg
ctgctgtacggactcatccatcaggggatgaagtgtgacacctgtgatatgaacgtgcac
aagcagtgcgtgataaacgtccccagcctctgtgggatggaccacacggagaagagaggc
cggatctacctgaaggccgaggtcaccgaggaaaagctccacgtcacagtacgagatgca
aaaaatctcatccctatggatccaaatgggctttcagatccttatgtgaagctgaagctt
attcctgaccccaagaacgaaagcaaacaaaaaaccaaaaccatccgttccacgctgaac
ccccagtggaatgagtcctttaccttcaaattaaaaccttcagataaagaccgacgactg
tccgtagagatctgggactgggatcgaacaaccaggaacgacttcatggggtccctttcc
ttcggagtctcggagctgatgaagatgccagccagtggatggtacaagttgctgaaccaa
gaggagggtgagtactacaacgtgcccattccagaaggcgatgaggaaggcaacgcggag
ctgaggcagaagttcgagaaagccaagctcggccctgctggcaacaaagtcattagtcct
gaggacaggaggcagccttccaacaacctcgacagagtgaaactcactgacttcaacttc
ctcatggtgctgggcaagggcagcttcgggaaggtgatgctggcggacaggaaggggacg
gaggagctgtacgccgtcaagatactgaaaaaggacgtggtgatccaggacgacgacgtg
gagtgcaccctggtggagaagcgggtgctggcccttccggacaagcccccgttcctgacg
cagctgcattcctgcttccagacggtggatcggctgtactttgtcatggaatacgtcaat
ggcggggacctcatgtaccacatccagcaagtaggaaaatttaaggaaccgcaagcagtg
ttctacgcagcagagatttccatcgggttgttctttcttcataaaagaggaatcatttat
agagacctgaagttagataacgtcatgctggattcggaaggacatatcaagattgcggac
tttgggatgtgtaaggagcacatgatggacggggtcacgaccaggaccttctgtgggacc
ccggattacatcgccccggagataatcgcttatcagccgtatgggaaatccgtggactgg
tgggcctacggcgtcctgttatatgaaatgctggccgggcagcctccgtttgacggcgag
gatgaagacgagctgtttcagtccatcatggagcacaacgtctcgtacccgaagtccttg
tccagggaggctgtctccatctgcaaagggctgatgaccaaacaccccggcaagcggctg
ggctgcgggcccgagggagagcgggacgtgcgggaacataccttcttccggaggatcgac
tgggagaagctggagaacagggaggtccagccgcccttcaagcccaaagtgacttcctgc
accgaaatgcactgtgcagaggctgtgagccgaccgacctgtggcaaaggggcagaaaac
ttcgacaagttcttcacgcgagggcagcctgtcttgacgccacccgatcagctggtcatc
gctaacatcgaccagtctgactttgaagggttctcatatgtcaacccccagttcgtgcac
cccatcctgcagagcacagtatga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073166
Entry
103073166         CDS       T03090                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04062  Chemokine signaling pathway
lve04140  Autophagy - animal
lve04270  Vascular smooth muscle contraction
lve04621  NOD-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04722  Neurotrophin signaling pathway
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04930  Type II diabetes mellitus
lve04931  Insulin resistance
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve05020  Prion disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103073166 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    103073166 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    103073166 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    103073166 (PRKCD)
   04062 Chemokine signaling pathway
    103073166 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103073166 (PRKCD)
   04915 Estrogen signaling pathway
    103073166 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103073166 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103073166 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103073166 (PRKCD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    103073166 (PRKCD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103073166 (PRKCD)
   04931 Insulin resistance
    103073166 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103073166 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103073166 (PRKCD)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103073166 (PRKCD)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103073166 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C C1_2 zf-RING-like Kinase-like Pkinase_fungal Zf_RING PHD zf-RING_9 DZR APH DUF2318 FYVE_2
Other DBs
NCBI-GeneID: 103073166
NCBI-ProteinID: XP_007447283
UniProt: A0A340WCL0
LinkDB
Position
Un
AA seq 675 aa
MAPFLRISFNSYELGSLQAADEASQPFCAVRMKEALSTERGKTLVQRKPTMYPEWKSSFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDIDCKQSMRGEDGAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCRDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVYNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQMKVANLCGINQKLLAEALNQVTQRPAR
RSDSETAETVGIYQNFEKKPGVSGDDVPGTGTYGKIWESSTKCSIENFTFVKVLGKGSFG
KVLLAELKGKKEFFAIKALKKDVVLIDDDVECTMVEKRVLALSGENPFLTHLFCTFQTKD
HLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHQKGIIYRDLKLDNVML
DRDGHIKIADFGMCKENMFGDKQASTFCGTPDYIAPEILQGLKYSFSVDWWSFGVLLYEM
LIGQSPFHGDDEDELFESIRVDSPYYPRWITRESKDILEKLLERDTTRRLGVTGNIKIHP
FFKTINWALLEKRAVEPPFKPRVRSPGDYSNFDQEFLNEKPRLSYSDKNLIDSMDQTAFA
GFSFVNPRFERLLEN
NT seq 2028 nt   +upstreamnt  +downstreamnt
atggcaccgttcctgcgcatctccttcaactcctacgagctgggctccctgcaggccgca
gacgaggcaagccagcccttctgtgctgtgaggatgaaggaggcactcagcacagagcgt
gggaagacgctggtgcagaggaagcccaccatgtaccccgagtggaagtcctcgttcgat
gcccacatctacgaaggtcgcgtcatccagatcgtgctgatgcgagccgcggaggagcca
gtgtccgaggtgacagtgggtgtgtcggtgctggccgagcgctgcaagaagaacaatggc
aaggccgagttctggctggacctgcaaccccaggccaaggtgttgatgtctgtgcagtat
ttcctggaagacatagattgcaagcagtcaatgcggggtgaagacggggccaagtttcca
acgatgaaccgccgtggagccatcaaacaggccaaaattcactacatcaagaaccacgag
tttatcgccaccttctttggacagcctactttctgctctgtgtgcagagactttgtttgg
ggtctcaacaagcaaggctacaagtgcaggcagtgcaacgctgccatccacaagaaatgc
atcgacaagatcattggccggtgtacgggcactgcagccaacagccgggacaccatattc
cagaaagaacgtttcaacattgacatgccacaccggttcaaggtttataactacatgagc
cccacgttctgcgaccactgcggcagcctgctctgggggctggtgaagcagggattaaag
tgtgaagattgtggcatgaacgtgcaccataagtgccagatgaaggtggccaacctctgt
ggcatcaaccagaagctcctggccgaggccttgaaccaagtcacccagagacctgcccgg
aggtcggactccgagactgcagagactgttgggatctaccagaattttgagaagaagcca
ggagtctctggagatgatgtcccaggaactgggacctacggcaagatctgggagagcagc
accaagtgcagcattgagaacttcaccttcgttaaggtcctgggcaaaggcagctttggg
aaggtgctgctcgcagagctgaagggcaaaaaggaattcttcgccatcaaggccctcaag
aaggacgtggttctgatcgatgatgacgtggagtgcacgatggtggagaagcgggtgctg
gcgctctccggggagaatccctttctcacccatctcttctgcaccttccagaccaaggac
cacctgttctttgtgatggagttcctcaatgggggcgacctgatgtatcacatccaggac
aaaggccgcttcgagctctaccgtgccacgttttatgcagctgagatagtctgtggacta
cagtttctacaccagaaagggatcatttacagggaccttaagctggacaacgtgatgctg
gaccgggacggccacatcaagattgctgactttggcatgtgcaaggagaacatgtttggg
gacaaacaggccagcaccttctgtggcacccctgactacatcgcccccgagatcctgcag
ggcctgaagtactcattctccgtggactggtggtcctttggagtccttctctatgagatg
ctcattggtcagtcccccttccacggtgacgatgaggatgaactcttcgagtccatccgt
gtggactcaccgtattatccccgctggatcaccagggagtccaaggacatcctggagaag
ctgcttgaacgggatacaaccaggaggctgggagtgacaggaaacatcaaaatccacccc
ttcttcaagaccatcaactgggctctgctggagaaacgtgcagtggagccacccttcaag
cccagagtgaggtcccctggagactacagcaacttcgaccaggagttcctgaacgagaag
ccgcgcctctcctacagcgacaagaacctcatcgactccatggaccaaacagcatttgcc
ggcttctcctttgtgaaccccagatttgagaggctcctggaaaattga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090549
Entry
103090549         CDS       T03090                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04062  Chemokine signaling pathway
lve04064  NF-kappa B signaling pathway
lve04066  HIF-1 signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04150  mTOR signaling pathway
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04370  VEGF signaling pathway
lve04510  Focal adhesion
lve04540  Gap junction
lve04650  Natural killer cell mediated cytotoxicity
lve04662  B cell receptor signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04670  Leukocyte transendothelial migration
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04931  Insulin resistance
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve04960  Aldosterone-regulated sodium reabsorption
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04973  Carbohydrate digestion and absorption
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05140  Leishmaniasis
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05214  Glioma
lve05223  Non-small cell lung cancer
lve05225  Hepatocellular carcinoma
lve05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090549 (PRKCB)
   04012 ErbB signaling pathway
    103090549 (PRKCB)
   04014 Ras signaling pathway
    103090549 (PRKCB)
   04015 Rap1 signaling pathway
    103090549 (PRKCB)
   04310 Wnt signaling pathway
    103090549 (PRKCB)
   04370 VEGF signaling pathway
    103090549 (PRKCB)
   04064 NF-kappa B signaling pathway
    103090549 (PRKCB)
   04066 HIF-1 signaling pathway
    103090549 (PRKCB)
   04020 Calcium signaling pathway
    103090549 (PRKCB)
   04070 Phosphatidylinositol signaling system
    103090549 (PRKCB)
   04071 Sphingolipid signaling pathway
    103090549 (PRKCB)
   04150 mTOR signaling pathway
    103090549 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103090549 (PRKCB)
   04540 Gap junction
    103090549 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103090549 (PRKCB)
   04662 B cell receptor signaling pathway
    103090549 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    103090549 (PRKCB)
   04670 Leukocyte transendothelial migration
    103090549 (PRKCB)
   04062 Chemokine signaling pathway
    103090549 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    103090549 (PRKCB)
   04929 GnRH secretion
    103090549 (PRKCB)
   04912 GnRH signaling pathway
    103090549 (PRKCB)
   04921 Oxytocin signaling pathway
    103090549 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    103090549 (PRKCB)
   04918 Thyroid hormone synthesis
    103090549 (PRKCB)
   04919 Thyroid hormone signaling pathway
    103090549 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    103090549 (PRKCB)
   04916 Melanogenesis
    103090549 (PRKCB)
   04925 Aldosterone synthesis and secretion
    103090549 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103090549 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    103090549 (PRKCB)
   04971 Gastric acid secretion
    103090549 (PRKCB)
   04972 Pancreatic secretion
    103090549 (PRKCB)
   04973 Carbohydrate digestion and absorption
    103090549 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103090549 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103090549 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103090549 (PRKCB)
   04727 GABAergic synapse
    103090549 (PRKCB)
   04725 Cholinergic synapse
    103090549 (PRKCB)
   04728 Dopaminergic synapse
    103090549 (PRKCB)
   04726 Serotonergic synapse
    103090549 (PRKCB)
   04720 Long-term potentiation
    103090549 (PRKCB)
   04730 Long-term depression
    103090549 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    103090549 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103090549 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103090549 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103090549 (PRKCB)
   05206 MicroRNAs in cancer
    103090549 (PRKCB)
   05205 Proteoglycans in cancer
    103090549 (PRKCB)
   05231 Choline metabolism in cancer
    103090549 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103090549 (PRKCB)
   05214 Glioma
    103090549 (PRKCB)
   05223 Non-small cell lung cancer
    103090549 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103090549 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    103090549 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    103090549 (PRKCB)
   05032 Morphine addiction
    103090549 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103090549 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103090549 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103090549 (PRKCB)
   05161 Hepatitis B
    103090549 (PRKCB)
   05171 Coronavirus disease - COVID-19
    103090549 (PRKCB)
   05164 Influenza A
    103090549 (PRKCB)
   05163 Human cytomegalovirus infection
    103090549 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103090549 (PRKCB)
   05140 Leishmaniasis
    103090549 (PRKCB)
   05143 African trypanosomiasis
    103090549 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103090549 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103090549 (PRKCB)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103090549 (PRKCB)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103090549 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 103090549
NCBI-ProteinID: XP_007450051
UniProt: A0A340WMW7
LinkDB
Position
Un
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKINQGTKAPEEKTTNTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RRGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcaca
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgag
tttgtcactttctcctgcccaggtgctgacaagggtccagcctctgatgacccccggagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggtccttatcgttgtcgtaagagatgct
aaaaaccttgtacctatggaccctaatggcttgtcagatccttacgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
ccggagtggaacgagacatttagattccagctgaaagagtctgacaaagacagaagactg
tctgtggagatttgggattgggatctgaccagcaggaatgacttcatgggatctttgtca
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtacctgtgccaccggaaggcagtgagggcaatgaggaa
ctgcggcagaaatttgagagggccaagatcaatcaggggaccaaggctcctgaagaaaag
acgactaacaccatatccaaatttgacaacaacgggaacagggaccggatgaaactgacc
gattttaacttcctgatggtgcttggaaaaggcagctttggcaaggtcatgctctcggag
cggaggggcacagacgagctgtacgccgtgaagatcctgaagaaggacgtggtgattcaa
gatgatgacgtggaatgcacgatggtggagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctgcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaatggtggcgacctcatgtaccacatccaacaagtgggccggttcaaggaa
cctcacgctgtattttatgctgcggaaattgccattggtctgttcttcttacagagcaag
ggcatcatttaccgagacctgaaacttgacaatgtgatgctggattctgagggtcacatc
aagatcgctgatttcggcatgtgtaaggaaaacatctgggatggagtgacaaccaagacc
ttctgtggcactccagactacatcgcccctgagataattgcttatcagccctatgggaag
tctgtggattggtgggcattcggagtcctgctgtatgagatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccagtctatcatggaacacaacgtggcttat
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcatgcgtttttc
cggtatattgactgggagaaactcgaacgcaaagagattcaacccccgtataagccgaaa
gcctgtgggcgaaatgctgaaaacttcgaccggtttttcacccgccatccaccagtccta
acacctcctgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system