KEGG   Lipotes vexillifer (Yangtze River dolphin): 103073757
Entry
103073757         CDS       T03090                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04014  Ras signaling pathway
lve04390  Hippo signaling pathway
lve04392  Hippo signaling pathway - multiple species
lve05200  Pathways in cancer
lve05206  MicroRNAs in cancer
lve05219  Bladder cancer
lve05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103073757 (RASSF1)
   04390 Hippo signaling pathway
    103073757 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    103073757 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103073757 (RASSF1)
   05206 MicroRNAs in cancer
    103073757 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    103073757 (RASSF1)
   05223 Non-small cell lung cancer
    103073757 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 103073757
NCBI-ProteinID: XP_007451865
UniProt: A0A340WYF6
LinkDB
Position
Un
AA seq 344 aa
MSAEPELIELRDLAPARCAAPGRTRLERANALRIAPGTARNTARQLVPGRGHRFQPAGPT
THTWCDLCGDFIWGVVRKGLQCAPLSADCKFTCHYRCRALVCLDCCGPRDLGWEPALERD
TNVDEPVEWETPDLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSV
PASKKPPSLQDARRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVV
DDPRKFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAF
SMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtccgctgagcctgagctcattgagctgcgggacctggcacccgcgcggtgcgctgcc
ccgggccgcacccggctcgagcgtgctaacgcgctgcgcatcgcgccgggcacagcgcgc
aacaccgcaaggcagctggtcccaggccgcggccaccgcttccagcccgcggggcccact
acgcacacatggtgcgacctctgtggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcacccctctctgcagattgcaagttcacctgccactaccgttgccgcgcgctc
gtctgcctagactgctgcggaccccgggacctgggctgggaaccggcgctggagcgggac
acgaatgtggatgagcccgtggagtgggagacacctgacctttctcaagctgagattgag
cagaagatcaaggagtacaatggccagatcaacagcaacttgttcatgagcctgaacaag
gatggctcctacacaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagtt
cccgccagcaagaagccaccctccttgcaggatgcccggcggggcccagggcggggtaca
gctgtgaaacgccgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtc
ttgtcacgcacacgggcacgtgaggtcatcgaggccctgctgcgcaagttcttggtggtg
gatgacccccgcaagtttgcactttttgagcgggctgagcgccatggccaagtgtacctc
cggaagctgtcagatgatgagcagcccctacggctacggctccttgcagggcccagtgag
aaggccctaagctttgtcctgaaggagaatgactctggggaggtgaactgggatgctttc
agcatgcctgagctacacaacttcctacgcatcctgcagcgggaggaagaggaacatctc
cgccagatcctgcagaagtactcgtattgccgccagaagatccaggaagccctgcatgcc
tgccccctggggtga

DBGET integrated database retrieval system