KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074098Help
Entry
103074098         CDS       T03090                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103074098 (TGM1)
Enzymes [BR:lve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103074098 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core Hepcidin DUF4232
Motif
Other DBs
NCBI-GeneID: 103074098
NCBI-ProteinID: XP_007447957
UniProt: A0A340WK35
LinkDB All DBs
Position
Un
AA seq 830 aa AA seqDB search
MPAPSSGTTTGSPCSDVGRWGGNPWQPLMTPSPEPEPDRHARQGSLPFWARCCGCCSRQN
AIDDDWGPEPNGDHGSNSRARRPSPRDPRPDSRGRRPDSLGRRPDSPGSTVNIARDGTIQ
EGMLVVTGVDLLSSPSDQNRQEHHTDEFEYNELIIRRGQPFHMVLFLSRPYGSSDRVTLE
LLIGNNPEVGKGTHVIIPVGQGGSGGWNAQVTKSSGKNLSLRVHTSPNAIIGKFQFTVRT
RSEAGEFQLPFDPCNEIYILFNPWCPEDIVYVDREDWRQEYVLNECGRIYYGTESQIGER
TWNYGQFDHGVLDACLYILDRRGMPYGGRRDPISVCRVVSAMVNSLDDNGILIGNWSGEY
SRGTNPSAWVGSVEILLSYLRTGFSVPYGQCWVFAGVTTTVLRCLGLATRTITNFNSAHD
TDTSLTMDIYFDENMKPLEHLNRDSVWNFHVWNECWMKRPDLPPGFDGWQVVDATPQETS
SGIFCCGPCSVESIKNGLVYMKYDTPFVFAEVNSDKIYWQRQGDGSFKIVCVEEKAIGSL
VVTKAVGSNMREEVSHIYKHPEGSEAERKAVETAAAHGSKPNVYATRDSAEDVALKVEAQ
DAVMGQDLTICVVLTNCSSSPRTVRLHLYLSVTFYTGVSGSVFKESKKEVVLAPGASERT
ALPVAYKEYRVHLVDQGAMLLNISGHVKESTQVLAKQHTFRLRTPDLSLTLLRAAVVGQE
CEVQIVFQNPLPVTLTNVVFRLEGSGLQRPKTLNAGDIEGNKRVTLRQTFMPVRPGSRQL
IASLDSPQLSQVHGVIQVDVAPTAGGRGFSDTRGNGSSEETNPIASXGGA
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaccttcgtcaggcacgacgacgggcagtccttgttcagatgtgggccgctgg
ggcgggaacccctggcagcccctcatgacaccttctccagagccagagccagacagacat
gctcgccaagggagcctccccttctgggctcgctgctgtggctgctgctcgcgccagaat
gcaatagatgacgactgggggcctgagcccaatggagaccacgggtctaactccagggct
cgaaggcccagccccagggatccgagacccgactcccggggtcgaagacccgactccctg
ggtcgaagacctgactccccgggcagcactgtgaacatagctagagatggcaccatccaa
gagggaatgctggtggtgactggtgtggatctgctgagttcaccctcggaccagaatcgc
caagagcaccacacggacgagttcgagtacaatgagctgattatccgccgtgggcagccc
ttccacatggtcctcttcctgtctcgtccctatgggtcgtccgatcgtgtcaccctggag
ctgttgatcggaaacaaccctgaggtgggcaagggcacccacgtgatcatcccagtgggc
caggggggcagtggaggctggaatgcccaggtgaccaagtccagcgggaagaatctgagc
ctacgggtccacacctcccccaatgccatcatcggcaagtttcagttcacggtccgcaca
cgctcagaagctggcgagttccagttgccctttgacccctgcaatgagatctacatcctc
ttcaatccctggtgcccagaggacatcgtgtatgtggaccgtgaggactggcggcaggag
tacgtgcttaatgaatgtgggagaatttactatgggaccgaatcacagattggcgagcgg
acctggaactatggccagtttgaccacggggtgctggatgcctgcctgtacatcctggac
cggcggggcatgccatatggaggccgcagggaccccatcagtgtctgccgggtcgtctct
gccatggtaaactccttggatgacaatggcatcctgattgggaactggtctggagaatat
tcccgcggcacgaatccatcagcgtgggtgggcagcgtggagattctactcagctaccta
cgcactggcttctctgtcccttacggccagtgctgggttttcgccggtgtgaccactaca
gtgctgcgctgcctgggcctggccacccgtaccatcaccaacttcaattccgcgcacgac
acagacacatccctcaccatggacatctactttgacgagaacatgaagccactcgagcac
ctgaaccgtgattccgtctggaacttccacgtgtggaacgagtgttggatgaagaggccg
gatctgcccccaggcttcgatggatggcaggttgtggacgccacaccccaggagaccagc
agcggcatcttctgctgtggcccctgctctgtggagtccatcaagaacggcctggtctac
atgaagtatgacacgcccttcgttttcgctgaggtgaacagtgacaagatctactggcag
cggcaaggtgacggcagcttcaagatcgtgtgcgtggaggagaaagccatcggctcactc
gtcgtcacgaaggccgtcggctccaacatgcgggaagaggtctcccacatctataagcac
ccagaaggctcagaagcagagcggaaggcagtggagaccgcagccgcccacggcagcaaa
cccaacgtgtacgccacccgggactcggctgaggatgtggccctgaaggtggaggcgcag
gacgcagtgatggggcaggacctgaccatctgcgtggtgctgaccaactgcagcagcagc
ccccggactgtgaggctgcacctctacctctccgttaccttctataccggtgtctctggg
tctgtcttcaaggaaagcaagaaggaagtggtgctggcaccaggggcctcggagcgcaca
gccctgcccgtggcctacaaggagtaccgggtccacctcgtggaccagggggccatgctg
ctcaacatctcgggccacgtcaaggagagcacgcaggtgctggccaagcagcacaccttc
cgtctgcgcaccccggacctctccctcacgttactgcgagcagccgtggttggccaggag
tgcgaggtccagattgtcttccagaaccccctgcctgtcaccctcaccaacgttgtcttc
cggctcgagggttccgggttgcagagacccaagaccctcaacgctggggacattgagggc
aacaagagagtgacactgcgccagacgttcatgcctgtgagaccaggctcccgccagctc
atcgccagcttggacagcccgcagctctcccaggttcatggggtcatccaggtggatgtg
gccccaaccgctggtggcaggggcttctcagatactagaggcaacggtagctcagaggag
accaaccctattgcatcttgaggtggggcttag

DBGET integrated database retrieval system