KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074112
Entry
103074112         CDS       T03090                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04114  Oocyte meiosis
lve04140  Autophagy - animal
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04340  Hedgehog signaling pathway
lve04371  Apelin signaling pathway
lve04530  Tight junction
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04910  Insulin signaling pathway
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04976  Bile secretion
lve05012  Parkinson disease
lve05020  Prion disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05034  Alcoholism
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103074112 (PRKACA)
   04014 Ras signaling pathway
    103074112 (PRKACA)
   04310 Wnt signaling pathway
    103074112 (PRKACA)
   04340 Hedgehog signaling pathway
    103074112 (PRKACA)
   04371 Apelin signaling pathway
    103074112 (PRKACA)
   04020 Calcium signaling pathway
    103074112 (PRKACA)
   04024 cAMP signaling pathway
    103074112 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103074112 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103074112 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103074112 (PRKACA)
   04540 Gap junction
    103074112 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103074112 (PRKACA)
   04062 Chemokine signaling pathway
    103074112 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    103074112 (PRKACA)
   04910 Insulin signaling pathway
    103074112 (PRKACA)
   04922 Glucagon signaling pathway
    103074112 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    103074112 (PRKACA)
   04912 GnRH signaling pathway
    103074112 (PRKACA)
   04913 Ovarian steroidogenesis
    103074112 (PRKACA)
   04915 Estrogen signaling pathway
    103074112 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    103074112 (PRKACA)
   04921 Oxytocin signaling pathway
    103074112 (PRKACA)
   04926 Relaxin signaling pathway
    103074112 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    103074112 (PRKACA)
   04918 Thyroid hormone synthesis
    103074112 (PRKACA)
   04919 Thyroid hormone signaling pathway
    103074112 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    103074112 (PRKACA)
   04916 Melanogenesis
    103074112 (PRKACA)
   04924 Renin secretion
    103074112 (PRKACA)
   04925 Aldosterone synthesis and secretion
    103074112 (PRKACA)
   04927 Cortisol synthesis and secretion
    103074112 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103074112 (PRKACA)
   04270 Vascular smooth muscle contraction
    103074112 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    103074112 (PRKACA)
   04971 Gastric acid secretion
    103074112 (PRKACA)
   04976 Bile secretion
    103074112 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103074112 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103074112 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103074112 (PRKACA)
   04727 GABAergic synapse
    103074112 (PRKACA)
   04725 Cholinergic synapse
    103074112 (PRKACA)
   04728 Dopaminergic synapse
    103074112 (PRKACA)
   04726 Serotonergic synapse
    103074112 (PRKACA)
   04720 Long-term potentiation
    103074112 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    103074112 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    103074112 (PRKACA)
   04742 Taste transduction
    103074112 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    103074112 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    103074112 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    103074112 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103074112 (PRKACA)
   04714 Thermogenesis
    103074112 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103074112 (PRKACA)
   05205 Proteoglycans in cancer
    103074112 (PRKACA)
   05203 Viral carcinogenesis
    103074112 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103074112 (PRKACA)
   05020 Prion disease
    103074112 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    103074112 (PRKACA)
   05031 Amphetamine addiction
    103074112 (PRKACA)
   05032 Morphine addiction
    103074112 (PRKACA)
   05034 Alcoholism
    103074112 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103074112 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103074112 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103074112 (PRKACA)
   05163 Human cytomegalovirus infection
    103074112 (PRKACA)
   05165 Human papillomavirus infection
    103074112 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103074112 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103074112 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103074112 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lve03019]
    103074112 (PRKACA)
   03036 Chromosome and associated proteins [BR:lve03036]
    103074112 (PRKACA)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103074112 (PRKACA)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: AGC group
  PKA family
   103074112 (PRKACA)
Messenger RNA biogenesis [BR:lve03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103074112 (PRKACA)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103074112 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103074112
NCBI-ProteinID: XP_007469116
UniProt: A0A340Y602
LinkDB
Position
Un
AA seq 351 aa
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMI
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgccgccgcggccaagaagggcagcgagcaagagagcgtgaaagagttctta
gccaaagccaaagaagattttcttaaaaaatgggaaaatcctgctcagaatacagcccat
ttggatcagtttgaacgaatcaagaccctcggcacgggctccttcgggcgggtgatgctg
gtgaagcacaaggagaccgggaaccactttgccatgaagatcctcgacaagcagaaggtg
gtaaagctgaagcagattgagcacaccctgaatgaaaagcgcatcctgcaagcggtcaac
tttccgttccttgtcaaactcgagttctcattcaaggacaactcaaatttatacatgatc
atggagtacgtgcctggtggggagatgttctcacacctgcggcggatcgggaggttcagt
gagccccatgcccgcttctacgcagcccagattgtcctgacctttgagtacctgcactcg
ctcgatctcatctaccgggacctgaagccggagaacctccttatcgaccagcagggctac
attcaggtgacagacttcggtttcgccaagcgtgtgaaaggccgcacctggaccttgtgc
ggcacccccgagtacctggcccccgagatcatcctgagtaaaggctacaacaaagctgtg
gactggtgggccctgggggttctcatctatgagatggccgctggctacccgcccttcttc
gctgaccagcccatccagatctatgagaagattgtgtctgggaaggtgcggttcccgtcc
cacttcagctccgacctgaaggatctgctgcggaacctcctgcaggtggacctcaccaaa
cgttttgggaacctcaagaatggggtcaatgacatcaagaaccacaagtggtttgccacg
accgactggatcgccatctaccaaaggaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgagtctccatc
aatgagaagtgtggcaaggagttttctgagttttag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103077464
Entry
103077464         CDS       T03090                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04020  Calcium signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04114  Oocyte meiosis
lve04140  Autophagy - animal
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04340  Hedgehog signaling pathway
lve04371  Apelin signaling pathway
lve04530  Tight junction
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04740  Olfactory transduction
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04910  Insulin signaling pathway
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04976  Bile secretion
lve05012  Parkinson disease
lve05020  Prion disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05032  Morphine addiction
lve05034  Alcoholism
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103077464 (PRKACB)
   04014 Ras signaling pathway
    103077464 (PRKACB)
   04310 Wnt signaling pathway
    103077464 (PRKACB)
   04340 Hedgehog signaling pathway
    103077464 (PRKACB)
   04371 Apelin signaling pathway
    103077464 (PRKACB)
   04020 Calcium signaling pathway
    103077464 (PRKACB)
   04024 cAMP signaling pathway
    103077464 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103077464 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103077464 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103077464 (PRKACB)
   04540 Gap junction
    103077464 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103077464 (PRKACB)
   04062 Chemokine signaling pathway
    103077464 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    103077464 (PRKACB)
   04910 Insulin signaling pathway
    103077464 (PRKACB)
   04922 Glucagon signaling pathway
    103077464 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    103077464 (PRKACB)
   04912 GnRH signaling pathway
    103077464 (PRKACB)
   04913 Ovarian steroidogenesis
    103077464 (PRKACB)
   04915 Estrogen signaling pathway
    103077464 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    103077464 (PRKACB)
   04921 Oxytocin signaling pathway
    103077464 (PRKACB)
   04926 Relaxin signaling pathway
    103077464 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    103077464 (PRKACB)
   04918 Thyroid hormone synthesis
    103077464 (PRKACB)
   04919 Thyroid hormone signaling pathway
    103077464 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    103077464 (PRKACB)
   04916 Melanogenesis
    103077464 (PRKACB)
   04924 Renin secretion
    103077464 (PRKACB)
   04925 Aldosterone synthesis and secretion
    103077464 (PRKACB)
   04927 Cortisol synthesis and secretion
    103077464 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103077464 (PRKACB)
   04270 Vascular smooth muscle contraction
    103077464 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    103077464 (PRKACB)
   04971 Gastric acid secretion
    103077464 (PRKACB)
   04976 Bile secretion
    103077464 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103077464 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103077464 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103077464 (PRKACB)
   04727 GABAergic synapse
    103077464 (PRKACB)
   04725 Cholinergic synapse
    103077464 (PRKACB)
   04728 Dopaminergic synapse
    103077464 (PRKACB)
   04726 Serotonergic synapse
    103077464 (PRKACB)
   04720 Long-term potentiation
    103077464 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    103077464 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    103077464 (PRKACB)
   04742 Taste transduction
    103077464 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    103077464 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    103077464 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    103077464 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103077464 (PRKACB)
   04714 Thermogenesis
    103077464 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103077464 (PRKACB)
   05205 Proteoglycans in cancer
    103077464 (PRKACB)
   05203 Viral carcinogenesis
    103077464 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103077464 (PRKACB)
   05020 Prion disease
    103077464 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    103077464 (PRKACB)
   05031 Amphetamine addiction
    103077464 (PRKACB)
   05032 Morphine addiction
    103077464 (PRKACB)
   05034 Alcoholism
    103077464 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103077464 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103077464 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103077464 (PRKACB)
   05163 Human cytomegalovirus infection
    103077464 (PRKACB)
   05165 Human papillomavirus infection
    103077464 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103077464 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103077464 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103077464 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:lve03019]
    103077464 (PRKACB)
   03036 Chromosome and associated proteins [BR:lve03036]
    103077464 (PRKACB)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103077464 (PRKACB)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: AGC group
  PKA family
   103077464 (PRKACB)
Messenger RNA biogenesis [BR:lve03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     103077464 (PRKACB)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    103077464 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 103077464
NCBI-ProteinID: XP_007457305
UniProt: A0A340XE43
LinkDB
Position
Un
AA seq 274 aa
LQVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIG
RFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTW
TLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR
FPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIP
KFRGSGDTSNFDDYEEEDIRVSITEKCGKEFCEF
NT seq 825 nt   +upstreamnt  +downstreamnt
ttacaggttgttaaactgaagcaaatagagcacactttgaatgagaaaagaatattacag
gcagtgaattttccttttcttgttcgactggagtattcttttaaggataattctaattta
tacatggttatggaatatgtccctggtggtgaaatgttttcacatctaagaagaattgga
aggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaacattcgagtac
ctccattcactagacctcatctacagagatctaaaacctgaaaatctcttaattgaccat
caaggttatatccaggtcacagactttgggtttgccaaaagagttaaaggcagaacttgg
acattatgtggcactccagaatatttggctccagaaataattctcagcaagggctacaat
aaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagctggctacccc
ccattctttgcagaccaaccaattcagatttatgaaaagattgtttccggaaaggttcga
ttcccttctcacttcagttcagatctcaaggaccttctaaggaacctgctgcaggtggac
ctgacgaagcgatttggaaatctaaagaatggtgtgagtgatataaaaactcacaagtgg
tttgccacaactgattggattgctatttaccagaggaaggttgaagctccattcatacca
aagttcagaggctctggagataccagcaattttgatgactatgaagaagaagatatccgt
gtctctataacagaaaaatgtggaaaagaattttgtgaattttag

DBGET integrated database retrieval system