KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074308
Entry
103074308         CDS       T03090                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00220  Arginine biosynthesis
lve00330  Arginine and proline metabolism
lve01100  Metabolic pathways
lve04020  Calcium signaling pathway
lve04066  HIF-1 signaling pathway
lve04146  Peroxisome
lve04371  Apelin signaling pathway
lve04926  Relaxin signaling pathway
lve05010  Alzheimer disease
lve05014  Amyotrophic lateral sclerosis
lve05022  Pathways of neurodegeneration - multiple diseases
lve05133  Pertussis
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05146  Amoebiasis
lve05152  Tuberculosis
lve05200  Pathways in cancer
lve05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103074308 (NOS2)
   00330 Arginine and proline metabolism
    103074308 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103074308 (NOS2)
   04066 HIF-1 signaling pathway
    103074308 (NOS2)
   04020 Calcium signaling pathway
    103074308 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103074308 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103074308 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103074308 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103074308 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103074308 (NOS2)
   05014 Amyotrophic lateral sclerosis
    103074308 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103074308 (NOS2)
   05152 Tuberculosis
    103074308 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103074308 (NOS2)
   05145 Toxoplasmosis
    103074308 (NOS2)
   05140 Leishmaniasis
    103074308 (NOS2)
   05142 Chagas disease
    103074308 (NOS2)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103074308 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 103074308
NCBI-ProteinID: XP_007452460
UniProt: A0A340X020
LinkDB
Position
Un
AA seq 1157 aa
MACPWQFLFKAKAYKYDLTEEMDINNNVDKAPVSFCSPVTQDDPKCHSLGKHRNESPQPL
TGTAKQSPESLVKPAAPPSACPRHVRIKNWGSGMTFQDTLYHKAKGDLACKSRSCLGAIM
NPKSLTIGPRDKPTLPDELLPQAIEFVNQYYGSFQEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGTIRGDPASVELTQLCIDLGWKPKYG
RFDVVPLVLQADGRDPELFEIPPDLVFEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVIEINV
AVLHSFQKHNVTIMDHHSAAESFMRYMQNEYRSRGGCPADWIWLVPPISGSITPMFHQEM
LNYVLSPFYYYQVEAWKTHVWQDERRRPRRREIRFKVLVKAVLFASVLMRETMASRVRAT
ILFATETGRSETLARDLGALFSCAFNPKVLCMDEYRLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQIAPTGEGD
ELSGQEEAFRGWAVQTFKAACETFDVRGKQHIQIPKLYTANVTWDLHHYRLVQDSQPLDL
NKALSSMHAKHVFTMRLKSQQNLQSPKSSRTTLLVELSCEGSQGPSYLPGEHLGVFPGNQ
PALVQGILERVVDGPAPHQPMRLETLCENGSYWVRDKRLPTCSLSQALTYFLDITTPPTQ
LLLRKLAQLATDEAERQRLETLCQPSDYNKWKFTNSPTFLEVLEEFPSLRVSASFLLSQL
PVLKPRYYSISSSRDYAPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSNLKPQDPVPCF
VRSASGFQLPKDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHKGLQSGRMTLVFGCRRPD
EDHLYREEMLEMTRKGVLHEVHTAYSRLPDQPKVYVQDILRQQLADEVLHVLHEDQGHLY
VCGDVRAARDVARTLKQLVATALSLTEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAGLPSNTRAPSSHRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaagcctataagtatgatttgactgag
gaaatggatatcaacaacaatgtagacaaagcccctgtttccttttgcagtccagtgaca
caggatgaccccaaatgtcacagcctcggcaagcaccggaatgagtctccccagcccctc
acggggacagcaaagcagtctccagaatccctggtcaagccggctgcacccccatcggcc
tgcccacggcacgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
taccacaaggccaaaggggatctcgcttgcaagtccaggtcttgcctgggagccatcatg
aaccccaaaagtttgaccataggacccagggacaagcctaccctcccagatgagcttcta
cctcaagctattgaatttgtcaaccagtattacggctccttccaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgcaccccgctgc
atcgggaggatccagtggtccaacctgcaggtcttcgacgcgcggagctgttccacggcc
caggagatgttcgagcacatctgcagacacctgcgttatgccaccaacaacggcaacatc
aggtcggccatcaccgtgttcccccagcggagcgacgggaaacatgacttccgggtctgg
aacgcccagctcatccggtatgccggctaccagatgcctgatggcaccatcagaggggac
cctgccagcgtggagctcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtgcctctggtcctgcaggctgatggccgcgaccctgagctcttcgaa
atccctcccgaccttgtgtttgaggtgcccatggaacatcccaagtatgagtggttccgg
gagctggagctgaagtggtatgccctgccggccgtagccaacatgctgctcgaggtgggt
ggccttgagttcccagggtgccccttcaatggctggtatatgggcacggagatcggagtc
cgggacttctgtgacgtccaacgctacaacatcctggaggaagtgggcaggaggatgggc
ctggaaacacacaaggtggcctcactctggaaagaccgggctgtcattgagatcaatgtc
gctgtgctccacagtttccagaagcataatgtgaccatcatggaccaccactcagctgca
gagtccttcatgaggtacatgcagaatgagtaccggtcccgagggggctgcccagctgac
tggatttggctggtccccccaatttctggaagcatcacccccatgttccaccaggagatg
ttaaattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtc
tggcaggatgagaggcggagaccccggagaagagagattcgattcaaagtcttggtcaaa
gccgtgctgtttgcctcagtgctgatgcgtgagacaatggcttcccgggtcagagccacg
atcctctttgcaacagagacaggaagatcagaaacactggcccgggacctaggggccttg
ttcagctgtgccttcaaccctaaggttctctgcatggacgaatacaggctgagccatctg
gaggaggaacagctactgctggtggtgaccagcacgttcgggaacggagactcccccggc
aacggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaagttcagg
tatgccgtgtttggcctcggctccagcatgtaccctcagttctgcgcctttgctcatgac
atcgaccagaagttgtcccagctgggggcttctcagatcgccccaacaggggaaggggac
gagctcagcgggcaggaggaggccttccgtggctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtccgaggcaaacagcacattcagatccccaagctctacactgcc
aatgtgacctgggacctgcaccactaccggctcgtgcaagactcacagcctttggacctc
aacaaagccctcagcagtatgcacgccaagcatgtgttcaccatgaggctgaaatcgcag
cagaatctacagagtccaaaatccagccgtaccaccctcctggtggaactctcctgtgag
ggcagccaaggtccaagctacctgccgggagaacacctcggagttttcccaggcaaccag
ccagccctggtccaaggcatcctggagcgagtggtggatggccctgccccccaccaaccc
atgcgcctggagaccctctgcgagaacggcagctactgggtcagggacaagcgactgccc
acctgctcactcagccaggctctcacctatttcctggacatcaccaccccaccaacccag
ctgctgctccgaaagctggcccagctggccacggacgaggctgagaggcagaggctggag
accctgtgccagccgtctgattacaacaagtggaagttcaccaatagccccaccttcctg
gaggtgctggaggagttcccgtccctgcgggtgtccgccagcttcctgctctcccagctg
cctgtcctgaagccccggtactactccatcagctcctccagggactacgcacccacggag
atccacctcaccgtggccgtgctcacgtaccgcacccgagacggccagggtcccctgcac
cacggcgtctgcagcacatggctcagcaatctgaagccccaagacccagtgccctgcttt
gtgcgaagtgccagcggcttccagctccccaaggacccctcccacccttgcatcctcatc
gggcctggcacgggcatcgcccccttccgcagtttctggcagcagcggcttcatgatgcc
gagcacaaaggtctccagagtggccgcatgaccctggtgtttgggtgccgccgcccagat
gaggaccacctctaccgggaagagatgttggagatgacccggaagggggtgctgcatgag
gtgcacacagcctattctcgcctgcctgaccagcccaaggtctacgttcaagacatcctg
cggcaacagctggcggacgaggtgctgcacgtgctccacgaggaccagggccacctctac
gtctgcggggacgtgcgcgcggcccgggatgtggcccgcaccctgaagcaactggtggcc
accgcgctgagcctaactgaggagcaggtggaggactatttcttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcggggctgcccagcaataccagagctccaagctcccacaggagaagttaa

DBGET integrated database retrieval system