KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074337
Entry
103074337         CDS       T03090                                 

Definition
(RefSeq) putative gonadotropin-releasing hormone II receptor-like
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103074337
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103074337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lve04030]
    103074337
G protein-coupled receptors [BR:lve04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    103074337
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 103074337
NCBI-ProteinID: XP_007459442
UniProt: A0A340XH79
LinkDB
Position
Un
AA seq 289 aa
MSAGNGTPWGYATRNITVQWLAGDIACRTLMFLXLMAMYAAAFLPVVIGLDHQQAAVLHP
LGPCSTGRKLLGAAWVLVFPLAWKLFLFHTVRXAGPVPFTQCXTKGSFKAXWQETTXFTF
CCLFLLPLTAMTVCYSRTVLSVSSPRTRKGNHAPAGEFALHCSLDNRPHAHLQGLRLALL
VLLTFVLCWTSYNLLGLWYWFSPTMLTEVPPSLSHILFLFGLLSAPLDPLLYGAFTLGCQ
RGHQELSIDSSREGASGRMPQQEIHTLRQMKVQTNVAARKAGETKETFL
NT seq 870 nt   +upstreamnt  +downstreamnt
atgtcggcaggcaacggcaccccttggggttatgccaccaggaatatcactgttcaatgg
ctggccggggacatcgcatgtcggacactcatgttcctgnaactaatggccatgtatgcc
gcagctttcctgcctgtggtcattgggctcgaccaccagcaggcagccgtactccacccg
cttggaccctgctcaactggaaggaaacttctgggagcagcctgggtactcgttttcccg
cttgcctggaagctgttcctgttccacaccgtccgctgagctggtccagtccccttcact
cagtgtnncaccaaaggcagcttcaaggcttgatggcaagagaccaccntcttcaccttc
tgctgcctctttctgctgccactgactgccatgaccgtctgctatagccgcactgtcctc
agtgtgtccagtccccggacaaggaaggggaaccatgcccctgccggtgaatttgccctc
cactgctccttagacaatcgcccccatgctcatcttcagggtctgcgactggccctgctt
gtcttgctgaccttcgtcctctgctggacatcttataacctgctgggtctttggtactgg
ttctctcccaccatgctaactgaagtgcctcccagcctcagccacatccttttcctcttt
ggcctcctcagtgctcctctggatcctctcctctatggggccttcacccttggctgccaa
agagggcaccaagaacttagtatagactcctccagggaaggagcttctgggagaatgccc
caacaggagattcatacccttagacagatgaaagtacaaacaaatgtggcagcaagaaag
gcaggagaaacaaaagagacattcctatga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079467
Entry
103079467         CDS       T03090                                 

Gene name
GNRHR
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103079467 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103079467 (GNRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lve04030]
    103079467 (GNRHR)
G protein-coupled receptors [BR:lve04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    103079467 (GNRHR)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 103079467
NCBI-ProteinID: XP_007450240
UniProt: A0A340WTJ6
LinkDB
Position
Un
AA seq 328 aa
MANSASPEQNQSHCSAINSSIPLTQGNLPTLTLSGKIRVTVTFFLFLLSTTFNASFLLKL
QKWTQRKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLAVKSNKKLGQLMIGLAWLLSSIFAGPQLYIFRM
IHLEDDSGQTEGFSQCVTHCSFPQWWHQAFYNFFPFPCLFIIPLLIMLICNAKIIFTLTR
VLHQAPHKLQLNQSKNNIPQARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMVNRV
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcaaacagtgcctctcctgaacagaatcaaagtcactgctcagcaatcaacagcagc
atcccactgacacagggcaacctccccacactgaccttatctggaaagattcgagtgaca
gttactttcttcctttttctactctccacaactttcaatgcttctttcttgttgaaactt
cagaagtggactcaaaggaaagagaaagggaaaaaactctcaagaatgaaagtgctttta
aaacatttgaccttagccaacctgttggagactctgattgtcatgccactggatggaatg
tggaacattactgtgcaatggtatgctggagaactcctctgcaaagtcctcagctatctg
aagcttttctccatgtacgcccccgccttcatgatggtggtgatcagtctggaccgctcc
ctggccatcacgaggcccctagctgtgaaaagcaacaaaaagctcggacagctcatgatt
ggcttggcctggctcctcagtagcatctttgctggaccacagttatacatcttcaggatg
atccatttagaagatgactctggacagacagaaggtttttctcaatgtgtaacacactgc
agttttccacaatggtggcatcaagccttttacaactttttccccttcccctgcctcttc
atcatccctcttctaatcatgttgatctgcaatgcaaaaatcatcttcaccctgacaagg
gtccttcatcaggctccccacaaactacaactgaatcaatccaagaataatataccacaa
gctcgactgaggaccctaaagatgacggttgcatttgccacttcatttactgtctgctgg
actccctactatgtccttggaatttggtattggtttgatcctgaaatggtaaacagggtg
tcagatccagtaaatcacttcttctttctctttgcttttttaaatccatgctttgatcca
cttatatatggatatttctctctgtaa

DBGET integrated database retrieval system