KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074544
Entry
103074544         CDS       T03090                                 

Gene name
CACNA1D
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 D
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04218  Cellular senescence
lve04260  Cardiac muscle contraction
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04530  Tight junction
lve04713  Circadian entrainment
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04929  GnRH secretion
lve04930  Type II diabetes mellitus
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04973  Carbohydrate digestion and absorption
lve05010  Alzheimer disease
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05031  Amphetamine addiction
lve05410  Hypertrophic cardiomyopathy
lve05412  Arrhythmogenic right ventricular cardiomyopathy
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103074544 (CACNA1D)
   04020 Calcium signaling pathway
    103074544 (CACNA1D)
   04024 cAMP signaling pathway
    103074544 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    103074544 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103074544 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103074544 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103074544 (CACNA1D)
   04929 GnRH secretion
    103074544 (CACNA1D)
   04912 GnRH signaling pathway
    103074544 (CACNA1D)
   04921 Oxytocin signaling pathway
    103074544 (CACNA1D)
   04935 Growth hormone synthesis, secretion and action
    103074544 (CACNA1D)
   04924 Renin secretion
    103074544 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    103074544 (CACNA1D)
   04927 Cortisol synthesis and secretion
    103074544 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103074544 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    103074544 (CACNA1D)
   04270 Vascular smooth muscle contraction
    103074544 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103074544 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    103074544 (CACNA1D)
   04727 GABAergic synapse
    103074544 (CACNA1D)
   04725 Cholinergic synapse
    103074544 (CACNA1D)
   04728 Dopaminergic synapse
    103074544 (CACNA1D)
   04726 Serotonergic synapse
    103074544 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    103074544 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103074544 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103074544 (CACNA1D)
   05020 Prion disease
    103074544 (CACNA1D)
   05022 Pathways of neurodegeneration - multiple diseases
    103074544 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    103074544 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103074544 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103074544 (CACNA1D)
   05414 Dilated cardiomyopathy
    103074544 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103074544 (CACNA1D)
   04934 Cushing syndrome
    103074544 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103074544 (CACNA1D)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103074544 (CACNA1D)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 103074544
NCBI-ProteinID: XP_007447289
UniProt: A0A340WJK8
LinkDB
Position
Un
AA seq 2182 aa
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPAPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEGGGEESKRNTSMPASETESVNTENVSG
EGENQGCCGSLWCWCRRRGATKAGPSGCRRWGQAISKSKLSRRWRRWNRFSRRRCRAAVK
SVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQA
YFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVA
SLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQI
LTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESL
NTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTVDDYREEDEDKDPYPPC
DVPVGEEEEEEEEDEPEVPAGPRPRRMSELNMKEKITPIPEGSAFFILSKTNPIRVGCHK
LINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTF
GAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGL
KHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFIL
YKDGDVDNPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPI
YNYRVEISVFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALK
ARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILN
MVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIVDVALSEADPTESENVPVPT
ATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLF
FIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLC
DPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
LDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSD
GTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEV
TVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKSSTIALQAGLRTLHDIGPEIRRAISCD
LQDDEPEESKGKEEGDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPA
SDTEKPLFPPAGNSVCHNHHNHNSIGKQVPSSTNANLNNANMSKAAPGKRPSIGNLEHVS
ENGHHSFHKHGREPQRRSSIKRTRYYETYIRSDSGDEQFPTICREDPEIHGYFRDPCCLG
EQENFSSEECYEDDSSPTGSRQSYSCGYYTRYPGSSLDFERPRGYHHPQSFSEDDDSPVC
YDSRRSPRRRLLPPTPTSPRRSSFNFECLRRHSSQEEVPPSPAFPHRTALPLHLMQQQIM
AVAGLDSSKAQKYSPSHSTRSWATPPATPSYRDWTPCYTPLIQVERSEATDQVNGSLPSL
HRSSWYTDEPSVSYRTFTPASLTVPRSFHNKNSDKQRSADSLVEAVLISEGLGRYARDPK
FVSATKHEIADACDLTIDEMESAASNLLNGNVHPRANGAVGPVSRRQDYELQDFGPGYSD
EEPDPGRDEEDLADEMICITTL
NT seq 6549 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcagcatcaacggcagcagcaagcggaccac
gcgaacgaggcaaactatgcaagaggcaccaggctccctctttctggtgaaggaccaact
tctcagccgaatagctccaagcaaaccgtcctgtcttggcaagccgcgatcgacgctgct
agacaagccaaggctgcccaaactatgagcacctctgcacccgcacctgtaggatctctc
tcccaaagaaaacgtcagcaatatgccaagagcaaaaaacagggtaactcgtccaacagc
cgacctgcccgcgcccttttctgtttgtcactcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtcgaaacatttttgaagatt
atagcgtatggattattgctacatcctaatgcttatgttagaaatggatggaatttactg
gattttgttatagtaatagtaggattgtttagtgtaattttggaacaattaaccaaagaa
acagaaggcggcaaccactccagtggcaaatcgggaggctttgatgtcaaagccctccgc
gcctttcgagtgttacgaccacttcgactagtatcaggagtgcccagtttacaagttgtc
ctgaactccatcataaaagccatggttcccctccttcacatagcccttttggtgttattt
gtaatcataatctatgctattataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatatcgtagctgaggaggacccagcaccgtgtgcgttctca
gggaatggacgccagtgtaccgccaatggcacagagtgcaggagtggctgggttggcccc
aatggcggcatcaccaactttgataactttgcctttgctatgctcaccgtgtttcagtgc
atcaccatggagggctggacagacgtgctctactgggtaaatgatgcgataggatgggaa
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctcaaaggaaagggaaaaggcgaaagcgcgggga
gacttccagaagctgcgggaaaagcagcagctggaagaggatctcaagggctacttggac
tggatcacccaagcggaagacatcgatcccgagaacgaaggaggaggagaggaaagcaag
cgaaataccagcatgcccgccagtgagacggagtctgtgaacacggagaacgtgagtggg
gaaggcgagaaccaaggctgctgtgggagcctctggtgctggtgcagaagaagaggcgcc
accaaggccgggccctctgggtgtcggcggtggggtcaagccatctcaaagtccaagctc
agccgacgctggcgccgctggaaccgcttcagtcgcagaaggtgtagggctgctgtgaag
tcggtcacgttttactggctggttattgtcctggtgtttctcaacaccttaaccatttcc
tctgagcactacaaccagcctgactggttgacacagattcaagatatcgctaacaaagtc
ctcttggctctgttcacctgcgagatgcttgtaaagatgtacagcttgggtctccaggca
tatttcgtctctcttttcaatcggtttgattgcttcgtggtgtgtggaggaattactgaa
acgatcttggtggaactggaaatcatgtctcctctgggcatctctgtgtttcgctgtgtt
cggctcttgagaattttcaaagtgaccaggcactggacctccctgagcaacttggtggca
tccttgttaaactccatgaagtccatcgcttcgctgctgcttctgctttttctcttcatc
atcatcttttccttgctggggatgcagctgttcggcggcaagtttaattttgacgaaacg
caaaccaagcggagcacctttgataatttccctcaagcgcttctaacggtgttccagatc
ctgacaggtgaagactggaacgctgtgatgtacgacggcattatggcgtacgggggcccg
tcgtcttcgggaatgatcgtctgcatctacttcatcatcctcttcatttgtggtaactat
attctactgaatgtcttcttggccatcgctgtagacaatttggcagatgctgaaagtttg
aatactgctcagaaagaggaagctgaagaaaaggaaagaaagaagattgccagaaaagaa
agcctggaaaataaaaagaacaacaaaccagaagtcaaccagatagccaacagtgacaac
aaggtcaccgtcgatgactaccgagaagaggatgaggacaaagacccctacccgccttgt
gatgtgccagtaggtgaagaggaagaggaggaggaagaggatgaacccgaggttcctgct
ggaccccgtcctcgaagaatgtctgagttgaacatgaaagagaaaatcacccccatcccc
gaagggagcgctttcttcattcttagcaagaccaacccgatccgcgtgggctgccacaag
ctcatcaaccaccacatcttcaccaaccttatcctcgtcttcatcatgctgagcagcgct
gccctcgccgccgaggaccccatccgcagccactccttccggaacactatactgggttac
tttgactatgctttcacagccatctttactgttgaaatcctgttaaagatgacgactttt
ggagctttcctccacaaaggggctttctgcaggaactatttcaatttactggatatgctg
gtcgttggggtgtctctggtgtcatttgggatccaatccagtgccatctctgttgtgaag
atcctgagagtcttaagggttctgagaccgctcagggcaatcaacagagcaaaaggactt
aagcacgtggtccagtgcgtctttgtggccatccggacaattggcaacatcatgatcgtc
accaccctcctccagttcatgtttgcctgcatcggggtgcagctcttcaagggaaagttt
tatcgatgcacagatgaagccaagagtaaccccgaagaatgcagggggctcttcatcctc
tacaaggatggggatgtcgataaccccgtggtccgtgagaggatctggcaaaacagcgac
ttcaactttgacaacgtcctctcagctatgatggctctgttcacagtctccacgttcgag
ggctggcccgcgttgctgtacaaagccattgactcgaacggcgagaacgtcggccccatc
tacaactaccgcgtggagatctccgtcttcttcatcatctacatcatcatcgtggcattc
ttcatgatgaacatctttgtgggcttcgtcatcgtcacatttcaggagcagggggagaaa
gagtataagaactgtgagctggacaaaaatcagcgtcagtgtgttgaatacgccttgaaa
gcacgtcccttgcggagatacatccccaaaaacccctaccagtacaagttctggtacgtg
gtgaactcctcgcctttcgaatacatgatgtttgtcctcatcatgctcaacacactctgc
ttggccatgcagcactacgagcagtccaagatgtttaatgacgccatggacatcctgaac
atggtctttaccggggtgttcactgtcgagatggttttgaaagtcattgcatttaaacct
aaggggtactttagtgatgcctggaacacgtttgactccctcatcgtaatcggcagcatt
gtagacgtggcgctcagcgaagctgacccaactgaaagtgaaaatgtccctgtcccaact
gctacacctgggaactctgaagagagcaatagaatctccatcacctttttccgtcttttc
cgagtgatgcgattggtgaagcttctcagcaggggggaaggcatccggacactgctgtgg
acttttattaagtccttccaggcgctcccgtatgtcgcccttctcatcgccatgctgttc
ttcatctatgcggttatcggcatgcagatgtttgggaaagttgccatgagagataacaac
cagatcaacaggaacaacaatttccagacctttccccaggcagtactgctgctcttcagg
tgtgcgacgggggaggcctggcaggaaatcatgctggcctgcctcccgggaaagctctgt
gaccccgagtctgattacaaccccggggaggagtacacctgtgggagcaactttgccatt
gtttatttcatcagtttttacatgctctgcgcatttctgatcatcaacctgtttgtggct
gtcatcatggacaatttcgattatctgacccgggactggtctattctggggcctcaccat
ttagacgaattcaaaagaatatggtccgaatatgaccccgaggcaaagggaagaatcaag
cacctggacgtggtcactctgctccgccgcatccagcccccactggggtttgggaaattg
tgtccacacagggtagcctgcaagaggctagttgccatgaacatgccgctcaacagtgat
gggacagtcatgtttaatgcaactctctttgccttggtccgaacggctcttaaaatcaag
acggaagggaacctagaacaagctaatgaagaactccgagctgtgatcaagaaaatctgg
aagaaaaccagcatgaaactacttgaccaagttgtccctccagctggtgatgatgaggta
accgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaagaaa
cggaaagaacaaggactggtgggaaaataccccgcgaagagcagcacaattgccctacag
gcgggattaaggacactgcacgacattgggccagaaatccggcgtgctatatcatgtgac
ttgcaagacgacgagccggaggaaagtaaaggcaaagaagaaggagatgtgttcaaaaga
aatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattccctt
cagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaattccacctgca
agtgatactgagaaaccgctgtttcctccagcaggaaattcggtgtgtcataaccatcat
aaccataattccataggaaagcaagttcccagctcaacaaatgccaatctcaataatgcc
aatatgtccaaagctgcccctggaaaacggcccagcattgggaaccttgagcatgtgtct
gaaaatgggcatcattccttccacaagcatggccgtgagcctcaaagaaggtccagtatt
aaaagaacgcgctattatgaaacttacattaggtctgactcaggagatgagcagttccca
actatttgccgggaagacccagagatacacggctacttccgggacccctgctgcttgggg
gaacaggagaacttcagcagcgaggagtgctacgaggacgacagctcgcccaccgggagc
aggcagagctacagctgtggctactatacccgatacccaggcagcagcttggacttcgag
cggcctcgaggctaccatcacccgcaaagcttctccgaggatgatgactcacctgtttgc
tatgattcccggaggtctccaaggagacgcctgctccctcccaccccaacatccccccgg
agatcctccttcaacttcgagtgcctgcgccggcacagcagccaggaggaggtcccgcca
tcccccgccttcccccaccgcacggccctgcctctgcacctgatgcagcaacagatcatg
gcagtcgccggcctagattccagtaaggcccagaagtactcgccgagccactccaccagg
tcgtgggccaccccgccagcgaccccgtcgtacagggactggacgccatgctacacccca
ctgatccaggtcgagcggtcggaggccacggaccaggtcaacggcagcctaccgtccctg
caccgcagctcgtggtacacggacgagcccagcgtctcctatcggacgttcacaccagcc
agcctgaccgtccccagaagcttccacaacaaaaacagcgacaagcagaggagcgcagac
agcttggtggaggcggttctgatatccgaaggcttagggcggtatgcgagggacccaaaa
ttcgtgtcagcgacaaaacatgaaatcgccgatgcctgtgacctaaccatcgacgagatg
gagagtgcagccagcaacctgctgaacggcaacgtgcatccccgggccaatggggccgtg
gggcccgtctcacgccggcaggactacgagctccaggacttcgggcccggctacagcgac
gaggagccagaccccgggagggatgaggaggacctggcggatgaaatgatttgcatcacc
accctgtag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082192
Entry
103082192         CDS       T03090                                 

Gene name
CACNA1F
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 F
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04260  Cardiac muscle contraction
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04723  Retrograde endocannabinoid signaling
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05410  Hypertrophic cardiomyopathy
lve05412  Arrhythmogenic right ventricular cardiomyopathy
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103082192 (CACNA1F)
   04020 Calcium signaling pathway
    103082192 (CACNA1F)
   04024 cAMP signaling pathway
    103082192 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    103082192 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103082192 (CACNA1F)
   04929 GnRH secretion
    103082192 (CACNA1F)
   04912 GnRH signaling pathway
    103082192 (CACNA1F)
   04921 Oxytocin signaling pathway
    103082192 (CACNA1F)
   04935 Growth hormone synthesis, secretion and action
    103082192 (CACNA1F)
   04924 Renin secretion
    103082192 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    103082192 (CACNA1F)
   04927 Cortisol synthesis and secretion
    103082192 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103082192 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    103082192 (CACNA1F)
   04270 Vascular smooth muscle contraction
    103082192 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    103082192 (CACNA1F)
   04725 Cholinergic synapse
    103082192 (CACNA1F)
   04726 Serotonergic synapse
    103082192 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    103082192 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103082192 (CACNA1F)
   05020 Prion disease
    103082192 (CACNA1F)
   05022 Pathways of neurodegeneration - multiple diseases
    103082192 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103082192 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103082192 (CACNA1F)
   05414 Dilated cardiomyopathy
    103082192 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103082192 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103082192 (CACNA1F)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103082192 (CACNA1F)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 103082192
NCBI-ProteinID: XP_007450974
UniProt: A0A340WV64
LinkDB
Position
Un
AA seq 1976 aa
MAASEGGKDTTPEPSPANGTGPGPEWGLCPGPPASGGEIGGASSLGTPKRRTQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETMLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGLGRACTLNQTECR
GRWAGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFILNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWITQAEELDMEDPS
ADGNFGSVAQEGQASHRPQLAELTNRRRGRLHWFSHSTHSTHSTSSHASLPASDTCSMAE
TPGDEEEEEGALASCTRCLNKIMRTSVCRCLRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPIWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSVYVSSFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTDKDKDREKNTEE
TPQENGALVPGGENEEEEGAKNEGAGMEEEEEEEEEEEEEEEGGAGHVELLQEVVPKEKV
VPIPEGSAFFCLSQTNPLRKACHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAQSFRNH
ILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSSAI
SVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLF
KGKFYSCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTV
STFEGWPALLYKAIDANAENKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITFRA
QGEQEYQDCELDKNQRQCVEYALKAQPLRRYIPKNPNQYRVWATVNSAAFEYLMFLLILL
NTVALAMQHYEQTAPFNYVMDILNMVFTGLFTVEMVLKIIAFKPKHYFTDAWNTFDALIV
VGSVVDIAVTEVNNGGHLGESSEDSSHISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIK
SFQALPYVALLIAMIFFIYAVIGMQIFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATG
EAWQEIMLASLPGSRCDPESDFGPGEEFSCGSNFAIAYFISFFMLCAFLIINLFVAVIMD
NFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHR
VACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRVK
QKLLDEVIPPADEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGAEAPPSTSSALQAGLR
SLQDLGPEMRQALTCDTDEEEEEEGQEGEEEEDEKDPETYKAPMGSQPPSRRSSVVSVSL
PAWDKPPDSLSLGPSDDDGGAPNSRQSSVPQAGSHAHRRSSGVLIFTIPEEGSSQSKATK
GQEKQDEQEEVPSQLSYLDEQAGTPPLPILLPPHRAQRYVDGHQAPRRRLLPPTPAGRKP
SFTIQCLWRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLYAPLLLVEEGAAG
DGYLGKSSNPLRTFTCLHMPGTHSDPSYGKRGSADSLVEAVLISEGLGLFARDPRFVALA
KREIADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGDEMACVHAL
NT seq 5931 nt   +upstreamnt  +downstreamnt
atggcggcatctgaaggcgggaaagacaccaccccagagcccagtccagccaacgggaca
ggccctgggcccgaatgggggctgtgccctgggcccccagcatcaggtggcgaaatcggc
ggggcatccagcctggggacccctaagcgaagaactcagcacagtaagcacaagacagtg
gcagtggccagtgcccagcgctcaccccgggcactcttctgcctcaccctggcaaacccc
ctgcggcggtcctgcatcagcatcgtggaatggaagcccttcgacatcctcatcctgctg
accatctttgccaactgcgtggcccttggggtctacatccccttcccagaggatgactcc
aacactgccaaccacaacctggagcaggtggagtacgtattcttggtgattttcactgtg
gagaccatgctcaagatcgtggcctacgggctggtgctccaccccagcgcctacatccgc
aatggctggaacctgctcgacttcatcatcgtcgtggtcgggctgttcagcgtgctgctg
gagcaggggcccggacgcccgggggacgccccgcataccggagggaagccgggtggcttc
gatgtgaaggcgttgcgggcgtttcgggtgctgaggccactgaggctggtgtccggggtc
ccgagcctgcacatagtgctcaattccatcatgaaggcgctggtgccgctgctgcatatc
gcacttctcgtgctctttgtcatcatcatttacgccatcatcggactcgagctgttcctc
ggacgcatgcacaaaacgtgctacttcctgggatcagacgtagaggcggaggaggaccca
tcgccctgtgcgtcatcgggattggggcgtgcttgtacgctaaaccagaccgagtgccgc
ggacgctgggcaggtcccaacggaggcatcaccaacttcgacaatttcttcttcgccatg
ctgacagtcttccagtgcatcaccatggaaggctggactgacgtgctctactggatgcag
gatgccatggggtatgagctgccctgggtgtatttcgtgagtcttgtcatctttggatcc
ttcttcatcctcaaccttgtacttggtgtcctgagtggagagttctccaaggagagggag
aaggcaaaagcgcgaggggacttccagaagcttcgagagaagcagcagctggaggaggac
ctgcggggctacctggactggatcacacaggcggaggagctggacatggaggacccctca
gctgatggcaactttggttctgtggctcaagagggccaggccagccaccggccgcaactg
gcagagctgaccaataggagacgaggacgtctgcactggttcagtcactccacccactcc
acacactccaccagcagccacgccagcctcccagccagtgacacctgttcgatggcagag
accccaggcgatgaggaagaggaagagggggctctggccagctgtacacgctgcctaaac
aagatcatgagaaccagtgtctgccgctgcctccgccgagccaaccggggccttcgggcg
cgctgccggcgggctgtgaagtccaatgcctgctactgggccgtgctgctgctcgtcttc
ctcaacacgctgaccatcgcctcggagcaccacgggcaacccatctggctcacccagatc
caggagtatgccaacaaagtgttgctctgtctgttcacggtggagatgcttctcaagtta
tatggtctggggccctctgtctacgtctcctccttcttcaaccgctttgactgcttcgtg
gtctgtgggggcatcctggagaccaccctggtggaggtgggcgccatgcagcccctgggc
atctcggtgctccgctgtgtgcgtctcctcaggatttttaaggtcaccaggcactgggca
tctctgagcaatttagtggcgtccctgctcaattcaatgaaatccattgcatccttgctg
cttctcctcttcctctttatcatcatcttctccctgcttggcatgcagctgtttgggggc
aagttcaactttgaccagacacacaccaagcgaagcacctttgacaccttcccccaggcc
ctcctcactgtctttcagatcctgacaggtgaggactggaatgtggtcatgtatgatggt
atcatggcctatggcggccccttcttcccagggatgctggtatgcgtgtacttcatcatc
ctcttcatctgcggcaactacatcctgttgaacgtttttcttgccattgctgtggacaac
ctggccagtggagatgcaggcactgacaaggacaaggacagggagaagaacactgaggaa
actccacaggagaatggagcactggtgcctggtggggagaatgaggaagaggaaggtgca
aaaaatgaaggagcaggcatggaggaagaggaggaggaggaggaggaggaagaggaggag
gaggaagggggtgcagggcatgtggaactcctgcaggaagttgtacccaaggagaaggtg
gtacccatccctgagggcagcgccttcttctgcctcagccaaaccaacccgctgaggaag
gcctgccacaccctcatccaccatcacgtcttcaccaatcttatcctggtgttcatcatc
ctcagcagtgtgtccctggcagctgaggaccccatccgagcccagtctttccgcaaccat
attctggggtacttcgattatgccttcacctccattttcactgtggagattctactaaag
atgacagtgttcggggctttcctgcaccgtggctccttctgccgtagctggttcaatctg
ttggatctgctggtggtcagcgtgtccctcatctcctttggcatccactccagtgccatc
tcggtggtgaagattcttcgagttctccgagtactacggcccctccgagccatcaacagg
gccaaaggactcaagcacgtggtgcagtgtgtgttcgtggccatccggaccatcgggaat
atcatgattgtgaccacgctcctgcaattcatgttcgcctgcattggcgtgcagctcttc
aaggggaaattctacagttgcactgatgaggccaaacacacaccccaagaatgcaagggc
tccttcctggtctaccccgatggagatgtgtcaaggcccctggtccgggagcggctctgg
gtcaacagtgatttcaactttgacaatgtcctttcagccatgatggccctgttcactgtc
tccaccttcgaaggctggcctgcgctgctatataaggccatcgatgcaaacgcagagaac
aagggccccatctataattaccacgtggagatctcagtgttcttcattgtctacatcatc
atcattgcattcttcatgatgaacatctttgtgggcttcgtcatcatcaccttccgtgcc
cagggcgagcaggagtaccaagactgtgagctggacaagaaccagcgccagtgtgtggag
tatgccctcaaggcccagccactccgccgctatatccccaagaacccgaatcagtatcgg
gtgtgggccactgtgaactctgctgccttcgagtatctcatgttcctgctcatcctgctc
aacacggttgctctagccatgcagcactatgagcagactgctcccttcaactatgtcatg
gacatcctcaacatggttttcactggtctcttcactgttgagatggtgctcaaaatcatc
gccttcaaacccaagcattactttaccgatgcctggaacacgtttgatgctcttattgtg
gtgggcagcgtagtggacattgccgtcactgaagtcaacaatggtggccatcttggcgag
agctctgaggacagttcccacatttcgatcactttctttcgcctcttccgagtcatgcgg
ctggtcaagcttctcagtaagggtgaagggattcgcacattactctggacattcatcaag
tccttccaggccttgccctatgtggctcttctcatcgcaatgatattcttcatttacgca
gtcattgggatgcagattttcggcaaggtggctcttcaggatggcacacagatcaaccga
aacaacaacttccagacctttccacaggctgtgctgcttttgttcaggtgtgctactggt
gaggcatggcaggagataatgcttgccagccttcctgggagccggtgtgaccctgagtct
gacttcggccctggtgaggagtttagctgtggtagcaattttgccatagcctattttatc
agcttcttcatgctctgtgcattcctgatcataaatctctttgtggctgtgatcatggac
aactttgattatctgaccagagattggtccatcctgggcccccatcacctcgatgaattc
aagaggatctggtctgaatatgaccctggggccaaaggccgcatcaagcacctggatgtg
gttgccctgctgagacgcatccagccacccctgggattcgggaagctgtgcccacaccga
gtggcctgcaagagacttgtggcgatgaacatgcctctcaactcagatgggacagtgaca
ttcaatgccacactctttgccctcgttcggacatccctgaagatcaagacagaagggaac
ctggagcaagccaatcaggagctgcggattgtcatcaaaaagatctggaagcgggtgaag
cagaagctgctagatgaggtcatccccccagctgacgaggaagaagttaccgtgggcaaa
ttctacgccacatttctgatccaggactatttccgcaaattccggcggaggaaagaaaag
gggctactaggggccgaggcccccccaagcacctcctctgcccttcaggctggtctgagg
agcctgcaagacttgggtcctgagatgcggcaggccctcacctgtgacacagatgaggag
gaggaggaagagggacaggagggagaggaggaggaagatgagaaggacccggaaacgtac
aaagccccaatgggctcccagcccccatctcgccggagctctgtggtttctgtgtctctg
cctgcctgggacaaaccaccagattcactttcccttgggcccagtgacgacgatgggggt
gctcccaactccagacagtccagtgtgccccaagctgggtcccacgcccacaggagaagc
tctggggttctcattttcaccattccggaagaaggaagttctcagtccaaggcaaccaaa
gggcaagagaagcaggatgaacaagaggaagtccccagccagctctcctacctagatgag
caggcagggactcccccactccccatcctcttgccacctcacagagcccagagatatgtg
gatggccaccaagcaccacgccgccgtctgctgcccccaacgcctgcaggccggaagcct
tccttcaccatccagtgtctgtggcgccagggcagttgtgaagatttacccatcccaggc
acctatcatcgtgggcgcaactcagggcccagcagggcacagggttcctgggcaacccct
cctcagcggggccggctcctatacgccccactgctgttggtggaggagggtgcagcaggg
gacggatacctcggcaaatccagcaatccactgcgcaccttcacctgtctgcacatgcct
ggaacccactcagaccccagctatggcaaaaggggcagtgctgacagcctggtggaggct
gtgctcatctccgagggcctgggcctgtttgcccgagacccgcgcttcgtggccctggcc
aagcgggagattgcagatgcatgtcgtctgacactggacgagatggacagtgccgccagt
gacctgctggcacaggggaccagctcactttatagtgacgaggagtccatcctctcccgc
tttgatgaggaggacctgggagacgagatggcctgcgtccatgccctctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087340
Entry
103087340         CDS       T03090                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04260  Cardiac muscle contraction
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04728  Dopaminergic synapse
lve04742  Taste transduction
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04929  GnRH secretion
lve04930  Type II diabetes mellitus
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05031  Amphetamine addiction
lve05410  Hypertrophic cardiomyopathy
lve05412  Arrhythmogenic right ventricular cardiomyopathy
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103087340 (CACNA1C)
   04020 Calcium signaling pathway
    103087340 (CACNA1C)
   04024 cAMP signaling pathway
    103087340 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    103087340 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103087340 (CACNA1C)
   04929 GnRH secretion
    103087340 (CACNA1C)
   04912 GnRH signaling pathway
    103087340 (CACNA1C)
   04921 Oxytocin signaling pathway
    103087340 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    103087340 (CACNA1C)
   04924 Renin secretion
    103087340 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    103087340 (CACNA1C)
   04927 Cortisol synthesis and secretion
    103087340 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103087340 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    103087340 (CACNA1C)
   04270 Vascular smooth muscle contraction
    103087340 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    103087340 (CACNA1C)
   04727 GABAergic synapse
    103087340 (CACNA1C)
   04725 Cholinergic synapse
    103087340 (CACNA1C)
   04728 Dopaminergic synapse
    103087340 (CACNA1C)
   04726 Serotonergic synapse
    103087340 (CACNA1C)
   04720 Long-term potentiation
    103087340 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    103087340 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    103087340 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103087340 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103087340 (CACNA1C)
   05020 Prion disease
    103087340 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    103087340 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    103087340 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103087340 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103087340 (CACNA1C)
   05414 Dilated cardiomyopathy
    103087340 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103087340 (CACNA1C)
   04934 Cushing syndrome
    103087340 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103087340 (CACNA1C)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103087340 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Glyco_hydro_cc
Other DBs
NCBI-GeneID: 103087340
NCBI-ProteinID: XP_007469545
UniProt: A0A340YDP1
LinkDB
Position
Un
AA seq 2112 aa
MNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKP
KKQGSTMATRPPRALLCLTLKNPIRRACISIVEWKYPLPFEIIILLTIFANCVALAIYIP
FPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVG
LFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMV
PLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQC
QNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFV
SLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAED
IDPENEDEGLDEEKPRNMSMPTSETESVNTENVAGGDIEGESCGARLAHRISKSKFSRYW
RRWNRFCRRKCRAAVKSSAFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLAL
FTAEMLLKTYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKVMSPLGISVLRCVRLLR
IFKITRYWNSLGNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRR
STFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLN
VFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPQKRQEAVEKPAVEETEEKIELK
SITADGGSPPATKINMDDLQPNENEDKSSYPNLETTGEEEEEPEMPVGPRPRPLSELHLK
EKAAPMPEASAFFIFSPSNRFRLQCHRVVNDSVFTNLILFFILLSSISLAAEDPVQHTSF
RNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRSCFNILDLLVVSVSLISFGIQS
SAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGV
QLFKGKLYTCSDSSKQTEAECKGNYVTYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMAL
FTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISVFFIIYIIIIAFFMMNIFVGFVIVT
FQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVL
ILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDC
LIVIGSVIDVILSETNPAEHTQCSPFMNAEENARISITFFRLFRVMRLVKLLSRGEGIRT
LLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLL
LFRCATGEAWQDVMLACMPGKKCAPGAEPGGSAEGEAPCGSSFAVFYFISFYTLCAFLII
NLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPL
GFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAI
IKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPARRNA
LSLQAGLRTLHDLGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVG
YYPSDSRSTFPQTFTTQRPLHISKAGTSQGDAESPSHEKLVDSTFIPSSYSSMGSNANIN
NANNTALGRCPCPAGQPGAVSVSTVEGRGPPLSPAVQVQGASWRLSSKRCPSRDSLIAMV
CQDEAPRDETCDLRMDEDAEYGSEPSLICTEMLSYQDDENRQLAPPEEDRRDIHLSPKRG
FLRSASLGRRASFHLECLKRQKNPGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHPPG
ALPPPPATPPATPGPAWPPRPVPTLQLEGAESSDKLTGSFPSVHCGPWAGEPTPCGAGGG
IRRARPVSLTVPSPAGPRGRPFHGSASSLVEAVLISEGLGQFAQDPRFLEATTQELADAC
DMTIEEMESAADNILSGGARQSPNGTLLPCANCRDPGPDREGGAEDAAWAPSPEPRQGGE
EPRDSRAFASSL
NT seq 6339 nt   +upstreamnt  +downstreamnt
atgaatgccaatgcggccgcggggctggcacctgagcacatccccacaccgggggccgcc
ctgtcctggcaggcagccattgacgcggcccggcaggccaagctgatgggcagcgctggc
aacgccaccatctccacggtcagctccacgcagcggaagcggcagcagtacgggaagccc
aagaaacagggcagcacgatggccacccgcccgccccgtgccctgctctgcctgaccctc
aagaaccccatccggagggcgtgcatcagcatcgtcgagtggaaatatcctttgccattt
gaaatcattattttactgacaatttttgccaactgtgtggccttagcgatctatattccc
tttccagaggacgactccaacgccaccaactccaacctggaacgggtggagtatctcttc
ctcatcatttttactgtggaagcatttttaaaagtcatagcctatgggctgctcttccac
cccaatgcttacctccgcaacggctggaacttgctggattttatcattgtggttgtcggg
cttttcagtgcaatcttagagcaagccaccaaagccgacggggccaacgccctgggaggg
aagggggctggatttgacgtgaaggcgctcagggcgttccgcgtgctgcggcccctacgg
ctggtgtccggggtcccgagtctccaggtggttctgaactccatcatcaaggctatggta
cccctgctgcacatcgctctgcttgtgctctttgtcattatcatctacgccatcatcggg
ctggagctcttcatggggaagatgcacaagacctgctacaaccaggagggcatcgcagat
gtcccagcagaagacgacccctccccctgtgccctggagacgggccacgggcggcagtgc
cagaacggcacggtgtgcaagccgggctgggatgggcccaagcacggcatcaccaacttc
gacaactttgcttttgccatgctgaccgtgttccagtgcatcaccatggagggctggacc
gacgtcctctactggatgcaggacgctatgggctacgagttaccctgggtgtattttgtc
agtctggtcatctttggatcctttttcgttctaaatctggttcttggtgtgttgagcgga
gagttctccaaggagagagagaaggccaaggcccggggcgacttccagaagctgcgggag
aagcagcagctggaagaggacctgaagggctacctggactggatcacgcaggcggaggac
atcgaccccgagaacgaggacgagggcttggacgaggagaaaccccgaaacatgagcatg
cccaccagtgagaccgagtctgtcaacaccgaaaacgtggctggaggtgacatcgaggga
gagagctgtggggccaggctggcccacaggatctccaagtcgaagtttagccgctactgg
cgccggtggaatcgcttctgcaggaggaagtgccgcgcggccgtgaagtcgagcgccttc
tactggcttgtcatcttcctggttttccttaacacgctcaccatcgcctctgagcactac
aaccagccccactggctcacggaagtccaagacacggccaacaaggcgctgctggccctg
ttcacggccgagatgctgctcaagacgtacagcctggggctgcaggcctacttcgtgtct
ctcttcaaccgcttcgactgcttcgtcgtgtgcggcggcatcctggagaccatcctggtg
gagaccaaggtcatgtcgccgctgggcatctccgtgctgagatgcgtacgcctcctgagg
atatttaagatcacgaggtactggaactccctgggcaacctggtggcttccctgctgaac
tctgtgcgctccatcgcctccctgcttctgctgctgtttcttttcatcatcatcttctcc
ctcctgggcatgcagctcttcggggggaagttcaactttgatgagatgcagacccggagg
agcacgttcgataacttcccccagtccctcctcaccgtgtttcagatcctgaccggggag
gactggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccaggg
atgttggtctgtatttacttcatcatcctcttcatctgtggaaattatatcctactgaat
gtgttcttggccattgccgtggacaacctggctgacgccgagagcctcacctcggcccag
aaggaggaggaagaggagaaggagaggaagaaactggccaggactgccagcccccagaag
agacaagaggcggtggagaagccggccgtggaggagaccgaggagaaaatcgagctgaaa
tccatcactgcggatggagggtcccctcctgccaccaagatcaacatggacgacctccag
cccaacgagaatgaagacaagagttcctaccccaacctggaaaccacaggagaggaagag
gaggagcctgagatgcccgtgggcccccgcccccgccccctctctgagctgcacctgaag
gagaaggcggcgcccatgccagaagccagcgccttctttatcttcagcccgagcaacagg
ttccgcctccagtgccatcgcgtcgtcaacgactccgtcttcaccaacctgatcctgttc
ttcatcctgctcagcagcatctccctggcggccgaggaccccgtccagcacacgtccttc
aggaaccacattctgttttattttgacattgttttcactaccattttcaccattgaaatt
gctctgaagatgaccgcctacggggccttcctgcacaagggctccttctgccgcagctgc
ttcaatatcctggacctgctggtggtcagcgtgtccctcatctccttcggcatccagtcc
agtgccatcaacgtggtgaagatcttgcgggtcctgagggtgctgaggcccctgagggcc
atcaacagggccaaggggctgaagcacgtggtgcagtgcgtgttcgtggccatccgcacc
atcgggaacatcgtgatcgtcaccacgctgctccagttcatgttcgcctgcatcggggtc
cagctcttcaagggcaagctctacacctgttcggacagttccaaacagacggaggccgaa
tgcaaggggaactacgtcacatacaaggacggggaggtggatcaccccatcatccagccc
cgcagctgggagaacagcaagtttgactttgacaacgtcctggcagctatgatggccctg
ttcaccgtctccacctttgaggggtggccagagctgctgtaccgctccatcgactcccac
acggaggacaagggccccatttacaactaccgcgtggagatctccgtcttcttcatcatc
tacatcatcatcatcgcctttttcatgatgaacatctttgtgggcttcgtcatcgtcacc
ttccaggagcagggggagcaggagtacaagaactgcgagctggacaagaaccagcggcag
tgcgtggagtacgccctgaaggcccggcccctgcggaggtacatccccaagaaccagcac
cagtacaaggtgtggtatgtggtcaactccacctacttcgagtacctgatgttcgtcctc
atcctgctcaacaccatctgcctggccatgcagcactacggccagagctgcctgttcaaa
atcgccatgaacatcctgaacatgctcttcactggcctcttcacggtggagatgattctg
aagctcatcgccttcaagcccaagggctactttagtgacccctggaatgtctttgactgc
ctcatcgtaattggcagcgtaattgacgtcattctcagtgagacgaatccagctgaacat
acccaatgctctccctttatgaacgcagaggagaacgcccgcatctccatcaccttcttc
cgcctcttccgggtcatgcgtctggtcaagctgctgagccgtggggagggcatccggacg
ctgctgtggacgttcatcaagtccttccaggccctgccctacgtcgccctcctgatcgtg
atgctgttctttatctacgccgtcatcgggatgcaggtgttcgggaaaatcgccctgaat
gacacgacagagatcaacaggaacaacaacttccagaccttcccccaggccgtgctgctg
ctcttcaggtgcgccaccggggaggcgtggcaggacgtcatgctggcctgcatgccgggc
aagaagtgcgcgcccggggcggagccgggcggcagcgccgagggggaggcgccctgcggc
agcagcttcgccgtcttctacttcatcagcttctacaccctgtgcgccttcctgatcatc
aacctcttcgtagctgtcatcatggacaactttgactacctgacaagggactggtccatt
ctgggtccccaccatctggacgaatttaagagaatctgggcggagtatgatcctgaagcc
aagggtcgcatcaaacacctggatgtggtgaccctgctccggaggattcagccccccctg
ggctttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaacatg
cccctgaacagcgacgggacggtcatgttcaacgccaccctgtttgccctggtccggaca
gccctgaggatcaaaacggaagggaacctggaacaggccaacgaggagctgcgggccatc
atcaagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccgcctgcg
ggagatgatgaggtcacggtgggcaagttttacgctactttcctgatccaagagtatttc
cggaaattcaagaagcgcaaggagcaaggcctggtgggcaagcccgcccggaggaacgcc
ctgtccctgcaggctggtctgcgcaccctgcatgaccttgggcccgagatccgccgggcc
atctccggggacctgaccgccgaggaggagctggacaaggccatgaaggaggctgtgtcc
gcggcctcggaagatgacatcttcaggagggccggcggcctgttcggcaaccacgtgggc
tactaccccagcgacagccggagcaccttcccccagaccttcaccacccagcgccctctg
cacatcagcaaggcgggcaccagccagggcgacgcggagtcgccctcccacgagaaactg
gtggactccaccttcatccccagcagctactcctccatgggttccaacgccaacatcaac
aacgccaacaacactgccctgggccgctgcccctgccctgccggccagcccggtgctgtc
agcgtcagcaccgtggagggccgtgggccccccttgtcccccgctgtccaggtgcagggg
gcttcgtggaggctcagctccaagaggtgcccctcccgggacagcctgatagccatggtg
tgtcaggacgaggcccctcgggatgagacttgtgacctgaggatggatgaggacgccgag
tacggcagtgagcccagcctgatctgcacggagatgctctcctaccaggacgacgagaat
cggcagctggcgccccctgaggaggacaggagagacatccatctctctccaaagaggggc
ttcctgcgctccgcctccctaggtcgaagggcctccttccaccttgagtgtctgaagcga
cagaagaatccagggggagacatctctcagaagacagttctgcccctgcatctcgttcac
catcaggcgctggcggtggcgggcctgagccccctcctgcagagaagccatccccccggc
gccctccccccgccgcctgccacgccccctgccacgcccggcccggcctggcccccgcgg
cctgtgcccaccctgcagctggagggggccgagtccagcgacaagctcaccggcagcttc
ccatccgtccactgcggcccctgggccggggagcccacgccctgcggggccggcggcggc
atccggagggcccggcccgtgtccctcaccgtgcccagcccggcggggccccggggccgg
cccttccacggcagcgccagcagcctggtggaggcggtcctgatctcagaaggactgggg
caatttgctcaggatcccaggttcctcgaggccaccacccaggagctggccgacgcctgc
gacatgaccattgaggagatggagagcgcggccgacaacatccttagcgggggcgcccgg
cagagccccaacggtaccctgctcccgtgtgcaaactgcagggacccggggccagacaga
gaggggggcgcagaggacgcggcctgggcacccagccccgagccccgccagggcggagag
gagccccgggacagcagggccttcgccagcagcctgtag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090575
Entry
103090575         CDS       T03090                                 

Gene name
CACNA1S
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04260  Cardiac muscle contraction
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04723  Retrograde endocannabinoid signaling
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04727  GABAergic synapse
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05410  Hypertrophic cardiomyopathy
lve05412  Arrhythmogenic right ventricular cardiomyopathy
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090575 (CACNA1S)
   04020 Calcium signaling pathway
    103090575 (CACNA1S)
   04024 cAMP signaling pathway
    103090575 (CACNA1S)
   04022 cGMP-PKG signaling pathway
    103090575 (CACNA1S)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103090575 (CACNA1S)
   04929 GnRH secretion
    103090575 (CACNA1S)
   04912 GnRH signaling pathway
    103090575 (CACNA1S)
   04921 Oxytocin signaling pathway
    103090575 (CACNA1S)
   04935 Growth hormone synthesis, secretion and action
    103090575 (CACNA1S)
   04924 Renin secretion
    103090575 (CACNA1S)
   04925 Aldosterone synthesis and secretion
    103090575 (CACNA1S)
   04927 Cortisol synthesis and secretion
    103090575 (CACNA1S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103090575 (CACNA1S)
   04261 Adrenergic signaling in cardiomyocytes
    103090575 (CACNA1S)
   04270 Vascular smooth muscle contraction
    103090575 (CACNA1S)
  09156 Nervous system
   04727 GABAergic synapse
    103090575 (CACNA1S)
   04725 Cholinergic synapse
    103090575 (CACNA1S)
   04726 Serotonergic synapse
    103090575 (CACNA1S)
   04723 Retrograde endocannabinoid signaling
    103090575 (CACNA1S)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103090575 (CACNA1S)
   05020 Prion disease
    103090575 (CACNA1S)
   05022 Pathways of neurodegeneration - multiple diseases
    103090575 (CACNA1S)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103090575 (CACNA1S)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103090575 (CACNA1S)
   05414 Dilated cardiomyopathy
    103090575 (CACNA1S)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103090575 (CACNA1S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:lve04040]
    103090575 (CACNA1S)
Ion channels [BR:lve04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103090575 (CACNA1S)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 103090575
NCBI-ProteinID: XP_007456198
UniProt: A0A340X3Q5
LinkDB
Position
Un
AA seq 1868 aa
MEPSSTQDEGLRRKQTKKPVPEVLPRPPRALFCLTLQNPVRRACISIVEWKPFETIILLT
IFANCVALAAYLPMPEDDSSALNLGLEKLELLFLIVFSIEAAMKIIAYGLLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSVFKAMQPLFRIALLVLFMAIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLD
EDLRGYLSWITQGEVMDVDDLREGKLALDEGGSDTESLYEIAGLNKVIQFIRHWRRWNRV
FRWKCHDAVKSRVFYWLVILIVALNTLSIASEHHHQPLWLTHLQDVASRVLLALFTVEML
MKMCGLGLHQYFMSIFNRFDCFVVCCGLLEILLVESGAAAPLGISVLRCIRLLRIFKITK
YWTSLSNLVASLLNSIHCIASLLLLLSLFVVIFALLGMQLFGGRYDFEDTVVRRSNFDNF
PQALITVFQVLTAEDWNSVMYDGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERRRRKMSRGLPDKSEEEKSMVAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPISPRPRPLAELQLKEKAVPIPEASAFF
VLSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRTESVRNQILGYFDIVFT
SIFTVEIVLKMTTYGAFLHKGSFCRNHFNILDLLVVAVSLISMGLESSTISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDL
SKMTEEECRGHYYVYKDGDPTQMELRPRQWTHNSFHFDNVLSAMMSLFTVSTFEGWPELL
YRAMDSQEEDGGPAHNRRPEVAVFFIAYIILVALFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLKCYIPKNPCQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMDHISDILNVAFTTIFTVEMVLKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGSCGNVDPDESARISSAFFRLFRVLRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGQLCDPESDYAPGEERTCGTDFAYYYFVSFYTLCAFLVINLFVAVV
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMRRQEEYYGYRPKKDTVQIQAGLR
TLEEEAAPEIRRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDSFLERSNSLPP
HMANQRPLQFTEIEMQELESPVFLEDFPQHPSTNPLARANTNNANANVAGGNSNHGNSPA
FSSVHSEGELPGETETPATRGGASGRPQRTLGPHSKSHGERLQGRLPRRVIPRAQAPAAP
CQLVGTQSLVPEERSPTPGSLPEEAPPKDGTPVCLAPATALLIREALVRGGLDTLAADAK
FVMATSHTLVEACQMELQEVEVAAAELLKGRETLEGVASARGRWSLGSSLGSLDQHQGSQ
ETLIPRRL
NT seq 5607 nt   +upstreamnt  +downstreamnt
atggagccgtcctcgacccaggatgagggcctgaggaggaagcagaccaagaagcctgtt
cccgaggtcctgcccaggccgccgcgggctttgttctgcttgactctccagaaccccgtg
aggagggcctgcatcagcatcgtggaatggaaacccttcgagaccatcatcttactcacc
atctttgccaactgtgtggccttggccgcgtacctgcccatgccggaggacgacagcagc
gctctgaacctcggcctggagaagctggagctcttgttcctcatcgtcttctccatcgag
gccgccatgaagatcatcgcctacggcctcctgttccaccaggacgcctacctgcgcagc
ggctggaacgtgctggactttatcatcgtcttcctgggggtcttcaccgtgattctggag
caggtcaacgtcatccagagcaacacagccccgatgagcagcaaaggcgccggcttggac
gtcaaggctctgagggccttccgcgtgctcagaccgctccggctggtgtccggggtgccc
agcctgcaggtggtcctcaactccgtcttcaaggccatgcagcccctgttccgcatcgcc
ctgcttgtgctcttcatggccatcatctacgccatcatcgggctggagctcttcaagggc
aagatgcacaagacctgttacttcatcgggacggacatcgtggccacggtggagaacgag
aagccgtcgccctgtgcccggacgggttcagggcgccgctgcaccatcaacggcagcgag
tgccggggcggctggccaggccccaaccacggcatcacccacttcgacaacttcggcttc
tccatgctcaccgtgtaccagtgcatcaccatggagggctggaccgacgtcctctactgg
gtcaacgatgccattgggaacgagtggccctggatctactttgtcaccctgatcctgctg
ggttccttcttcatcctcaacttggtgctgggcgtcctgagcggggaattcaccaaggag
cgggagaaagccaagtccaggggaaccttccagaagctgcgcgagaagcagcagctggat
gaggacctccggggctacttgagctggatcacgcagggcgaggtcatggatgtggacgac
ttgagagaagggaagctggctttggatgaaggtggctctgacacagagagcctgtatgaa
atcgcaggcttgaacaaagtcatccagtttatccgacactggaggcggtggaaccgcgtc
ttccgctggaagtgccacgacgcggtgaagtccagggtcttctactggctggtcatcctg
atcgtcgccctcaacaccctgtcgatcgcctcggaacaccaccaccagcctctctggttg
acccacctgcaagacgtcgccagccgggtgctgctggccctgttcaccgtggagatgctc
atgaagatgtgcgggctgggcctacatcagtacttcatgtccatcttcaaccgcttcgac
tgctttgtggtgtgctgtggcctcctggagatcctgctggtggagtcgggggccgcggca
cccctcggcatctccgtgctgcgctgcatccgcctcctcaggattttcaagatcaccaag
tactggacgtccctgagcaacctggtggcctcgctgctgaactccatccactgcatcgcg
tccctgctgctgctgctgtccctgttcgtcgtcatcttcgccctcctgggcatgcagctc
ttcgggggcaggtacgactttgaggacacggtggtgcggcgcagcaacttcgacaacttc
ccgcaggccctcatcaccgtcttccaggtgctgacagctgaggactggaactctgtgatg
tacgacgggatcatggcctacggcggcccgacctaccccggggtgctcgtctgcatctat
ttcatcattctgttcgtctgcggcaactacatactgctcaacgtcttcctggccatcgcg
gtagacaacctggcggaggcggagagcctgacgtcggcccagaaggccaaggccgaggag
cggaggcgcaggaagatgtccagggggcttccagacaagtcagaggaagagaagtcgatg
gtggccaagaagctggagcagaaacccaagggggagggtatccccaccacggccaagctg
aagatcgatgagtttgaatccaatgtcaatgaggtgaaggacccctacccgtcagccgac
ttcccaggagatgatgaggaagacgaacccgagatcccgataagcccccgaccccgcccg
ctggccgagctgcagctgaaggagaaggcggtgcccatcccagaagccagcgccttcttt
gtcctcagccccaccaataagatccgcgtcctgtgccaccgcatcgtcaacgccacctgg
ttcaccaacttcatcctgctcttcatcctgctgagcagcgccgcgctggctgccgaggac
cccatccggactgagtccgtgaggaaccagatccttgggtattttgacatcgtgttcacc
tctatcttcactgtggagattgtcctcaagatgaccacctacggggccttcctgcacaag
ggctccttctgccgtaatcacttcaacatcctggacctgctggtggtggccgtgtccctc
atctccatgggactcgagtctagcaccatctccgtggtgaaaatcctgagggtgctgagg
gtactccgaccgctccgggccatcaacagagccaaagggctgaagcacgtggtgcagtgt
gtgttcgtggccatccgcaccatcgggaacatcgtcctggtcaccaccctcctgcagttc
atgttcgcctgcatcggcgtccagctcttcaaggggaaattcttcagctgcaatgacttg
tccaagatgacagaggaggagtgcaggggccactactacgtgtacaaggatggggacccc
acgcagatggagctgcgcccccgccagtggacgcacaacagcttccacttcgacaacgtg
ctctcggccatgatgtcactcttcacggtgtccaccttcgaggggtggcctgagctgctg
tacagggccatggactctcaggaggaggacgggggccccgcgcacaacaggcgcccggag
gtggccgtcttcttcatcgcctacatcatcctcgtcgccctattcatgatgaacatcttc
gtgggcttcgtcatcgtcaccttccaggagcagggggagaccgagtacaagaactgcgag
ctggacaagaaccagcgccagtgcgtgcagtacgccctgaaggcccgccccctgaagtgc
tatatccccaaaaacccgtgccagtaccaggtgtggtacgtcgtcacctcctcctacttc
gagtacctaatgttcgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aaccagtcggagcagatggaccacatctcagacatcctcaacgtggccttcaccaccatc
ttcacggtggagatggtcctcaagctcatggcgttcaaggccaggggctattttggggac
ccctggaatgtgtttgacttcctgattgtcatcggcagcatcatcgacgtcatcctcagt
gagattgatactttcctggcctccagcgggggactgtattgcctgggtggcagctgcggg
aacgttgaccccgacgagagcgcccgcatctccagcgccttcttccgcctgttccgcgtc
ctgaggctgatcaagctgctgagccgcgcggagggcgtgcgcacgctgctctggaccttc
atcaagtcctttcaggccctgccctacgtggctctgctcatcgtcatgctcttctttatc
tacgccgtcatcggcatgcagatgttcgggaagattgccctggtggacgggacccagatc
aaccggaacaacaacttccagaccttcccccaggctgtgcttttgctgttcaggtgtgcc
acgggtgaggcgtggcaggagatcctgctggcctgcagctatggccagctgtgcgacccc
gagtcggactacgcgccgggggaggagcgcacctgtggcaccgacttcgcctactactac
tttgtcagcttctacacgctttgtgccttcctggtcatcaacctctttgtggctgtcgtc
atggacaactttgactacctcacacgggactggtccatcctgggccctcatcacctggac
gagttcaaggccatctgggcagagtatgacccagaggctaagggcagaatcaaacacctg
gacgtggtgaccctgctgagaaggatccagccccctctgggctttgggaagttctgccca
caccgggtagcatgtaagcggctggtgggcatgaacatgcccctgaacagcgacggcaca
gtcaccttcaacgccactctcttcgccctggtccgcacggcgctcaagatcaagacggaa
ggtaacttcgaacaggccaatgaggagctgcgggccatcatcaagaagatctggaagagg
accagcatgaagctcctggaccaggtcatccctcccataggagatgacgaggtgacggtg
ggaaagttctacgccacgtttctcatccaggagcacttccggaagttcatgaggcgccag
gaggaatattatgggtaccggcccaagaaggacaccgtgcagatccaggccggactgcgg
acccttgaggaagaggcagcccctgagatccgccgcaccatctcgggagacctgacggcc
gaggaagagctggagagagccatggtggaggccgcgatggaggaagggatattccggagg
accggaggcctgtttggccaggtggacagcttcctggaaaggtccaactccctgcctcca
cacatggccaaccagagacccctccagtttactgaaatagagatgcaggagctggagtcg
cccgtcttcttggaggacttccctcagcatccaagcaccaaccctcttgcccgtgccaac
accaacaatgccaacgccaacgttgccggtggcaacagcaaccatggcaacagcccggca
ttttccagcgtccactctgaaggggagctcccaggggagacagagacgcctgccaccaga
ggaggagcctccggccggccccagaggaccctgggaccccacagcaagtcccatggggag
aggctgcagggacggctgccccggagggtgatacccagagctcaggcacctgccgccccc
tgccagcttgtggggacacagtctctggtgcccgaggagaggagccccaccccagggtcc
ctgcctgaggaagcgccccccaaggatggtacccctgtgtgcctggccccagccacggcc
ctgctgatccgagaggctctggttcgagggggcctggacaccttggcggctgatgctaag
ttcgtcatggcaacgagccacaccctggtggaagcctgccagatggaactgcaggaagtg
gaggtggcagccgctgagcttctgaagggacgagagaccctggagggtgtggccagtgcc
cgggggcgttggagcctcgggtcctccctgggaagcctcgaccagcatcagggctcccag
gagaccctcattccccgcaggctgtga

DBGET integrated database retrieval system