KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074712
Entry
103074712         CDS       T03090                                 

Definition
(RefSeq) follitropin subunit beta-like
  KO
K05250  follitropin subunit beta
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04024  cAMP signaling pathway
lve04080  Neuroactive ligand-receptor interaction
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    103074712
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103074712
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103074712
   04913 Ovarian steroidogenesis
    103074712
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 103074712
NCBI-ProteinID: XP_007460994
UniProt: A0A340XNV8
LinkDB
Position
Un
AA seq 129 aa
MKVVQFCFLFCCWTAICCNCCELTNITITVEKEECGLCISMNTTWCAGYCYTRDLVYKDP
ARPNIQKTCTFKELMYETVKVPGCAHHADSLYTYPVASECHCGKCDSDSTDCTVQGLGPS
YCSFSEMKE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaaggtggtccagttttgctttctcttctgttgctggacagcaatctgctgcaactgc
tgtgagctgaccaacatcaccatcacagtggagaaagaggaatgtggcttatgcataagc
atgaacaccacatggtgtgcgggctactgctacacccgggatctagtgtacaaggatcca
gccaggcccaacatccagaaaacatgtaccttcaaggagctgatgtatgagacggtcaaa
gtgcctggctgtgctcaccatgcagactccctgtatacgtacccagtagcctctgaatgt
cactgtggcaagtgtgacagcgacagcactgactgcaccgtgcaaggcctgggacccagc
tactgctcgttcagtgaaatgaaagaataa

DBGET integrated database retrieval system