KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074882
Entry
103074882         CDS       T03090                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01523  Antifolate resistance
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04062  Chemokine signaling pathway
lve04064  NF-kappa B signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04380  Osteoclast differentiation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04623  Cytosolic DNA-sensing pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04668  TNF signaling pathway
lve04920  Adipocytokine signaling pathway
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05162  Measles
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05168  Herpes simplex virus 1 infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05203  Viral carcinogenesis
lve05212  Pancreatic cancer
lve05215  Prostate cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05222  Small cell lung cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05340  Primary immunodeficiency
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103074882 (IKBKG)
   04014 Ras signaling pathway
    103074882 (IKBKG)
   04064 NF-kappa B signaling pathway
    103074882 (IKBKG)
   04668 TNF signaling pathway
    103074882 (IKBKG)
   04151 PI3K-Akt signaling pathway
    103074882 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103074882 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103074882 (IKBKG)
   04621 NOD-like receptor signaling pathway
    103074882 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    103074882 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    103074882 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    103074882 (IKBKG)
   04660 T cell receptor signaling pathway
    103074882 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    103074882 (IKBKG)
   04659 Th17 cell differentiation
    103074882 (IKBKG)
   04657 IL-17 signaling pathway
    103074882 (IKBKG)
   04662 B cell receptor signaling pathway
    103074882 (IKBKG)
   04062 Chemokine signaling pathway
    103074882 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103074882 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103074882 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103074882 (IKBKG)
   05203 Viral carcinogenesis
    103074882 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103074882 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103074882 (IKBKG)
   05221 Acute myeloid leukemia
    103074882 (IKBKG)
   05220 Chronic myeloid leukemia
    103074882 (IKBKG)
   05215 Prostate cancer
    103074882 (IKBKG)
   05222 Small cell lung cancer
    103074882 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    103074882 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103074882 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103074882 (IKBKG)
   05135 Yersinia infection
    103074882 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103074882 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    103074882 (IKBKG)
   05162 Measles
    103074882 (IKBKG)
   05164 Influenza A
    103074882 (IKBKG)
   05161 Hepatitis B
    103074882 (IKBKG)
   05160 Hepatitis C
    103074882 (IKBKG)
   05168 Herpes simplex virus 1 infection
    103074882 (IKBKG)
   05163 Human cytomegalovirus infection
    103074882 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103074882 (IKBKG)
   05169 Epstein-Barr virus infection
    103074882 (IKBKG)
   05165 Human papillomavirus infection
    103074882 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103074882 (IKBKG)
   05142 Chagas disease
    103074882 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    103074882 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103074882 (IKBKG)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   103074882 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB LLC1 zf_C2H2_ZHX Bacillus_HBL
Other DBs
NCBI-GeneID: 103074882
NCBI-ProteinID: XP_007457507
UniProt: A0A340XBQ7
LinkDB
Position
Un
AA seq 419 aa
MSRPPWKSPLYEMVQPSGGPAGDQDVLGEESSLGKPAMLHLPSEQAAPETFQRCLEENQE
LRDAIRQSNQMLRERCEELQRFQGSQREEKAFLMQKFQEARDLVERLSLERRELHRQREQ
ALQEVERLKTCQQQMAEDKASVKAQVTSLLGELQESQSRLEATTKERQALEGRVRAASEQ
ARQLENEREALQQQHSVQVDQLRLQNQSMDAALRMERQAASEEKRKLAQLQVAYHQLFQE
YDSHIKSSMVSSERNRGLQLEDLKQQLKQAEEALVAKQELIDKLKEEAEQHKTVMETVPV
LKAQADIYKADFQAERQAREKLAEKKEFLQAQLEQLQREHNRLKTSCQESARIEDMRKRH
VEVSQPPLAPAPAHHSFHLALPSQRRSPPEEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcccccttggaagagtccactgtatgagatggtgcagcctagcggcgggccg
gcaggggaccaggacgtgctgggtgaagagtcttctctggggaagccagccatgctccac
ctgccttcagagcaggctgctcctgagaccttccagcgttgtctggaggagaatcaagag
ctccgagacgccatccgccagagcaaccagatgctgcgggaacgctgcgaggagctgcag
cgtttccagggcagccagagggaggagaaggccttcctcatgcagaagttccaggaggcc
cgggacctggtggagaggctgagcctggagaggcgggagctgcaccggcagagggagcag
gccctgcaggaggtggagcgcctcaagacatgccagcagcagatggccgaggacaaggcc
tcagtgaaagcccaggtgacatccttgctgggggagctgcaggagagccagagtcgcttg
gaggccaccaccaaggagcggcaggctttggagggcagggtccgggccgccagcgagcag
gcccggcagctggagaacgagcgtgaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcctgcagaaccagagcatggatgctgccctgcgcatggagcgccaggctgcc
tcggaggagaagaggaagctggcccagctgcaggtggcctatcaccagctcttccaagag
tatgacagccacatcaagagcagcatggtgagcagtgagcggaaccgaggattgcagctg
gaagatctcaagcagcagctcaagcaggccgaggaggccctggtggctaaacaggagctg
atcgacaaactgaaggaagaggctgagcaacacaagactgtgatggagacggttccggtg
ctgaaagcccaggcggatatctacaaggcggatttccaggctgagaggcaggcccgggag
aagctggctgagaagaaggagttcctgcaggcgcagctggagcagctgcagagggagcac
aacaggctgaagaccagctgtcaggagtcggccaggatcgaagacatgaggaagcggcat
gtagaggtctcccagccccccttagcccctgccccagctcatcactcctttcacctggcc
ctgcccagccagaggagaagcccccctgaggagccgcccaacttctgctgccccaagtgc
cagtatcaggctcctgacatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system