KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074900
Entry
103074900         CDS       T03090                                 

Gene name
HBEGF
Definition
(RefSeq) heparin binding EGF like growth factor
  KO
K08523  heparin-binding EGF-like growth factor
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04012  ErbB signaling pathway
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve05171  Coronavirus disease - COVID-19
lve05205  Proteoglycans in cancer
lve05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103074900 (HBEGF)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103074900 (HBEGF)
   04915 Estrogen signaling pathway
    103074900 (HBEGF)
   04928 Parathyroid hormone synthesis, secretion and action
    103074900 (HBEGF)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103074900 (HBEGF)
  09162 Cancer: specific types
   05219 Bladder cancer
    103074900 (HBEGF)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103074900 (HBEGF)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103074900 (HBEGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:lve00536]
    103074900 (HBEGF)
Glycosaminoglycan binding proteins [BR:lve00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103074900 (HBEGF)
SSDB
Motif
Pfam: EGF Ninjurin NdhL
Other DBs
NCBI-GeneID: 103074900
NCBI-ProteinID: XP_007461513
UniProt: A0A340XJA1
LinkDB
Position
Un
AA seq 208 aa
MKLLPSVVLKLLLAAVLSALVTGDSLERLRRGLAAGTSNLDSPTQSTDQLLPPGGGRGRE
VLDLEETDLDLFRAAFSSKPQALATPSKDERGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVKNRLYTYDHTTILVVVVVVLSSVCLLVIVG
LLMFWYHRRGGYDVENEEKVKLGMTTSH
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaagctgctgccgtcggtggtgctgaagctccttttggctgcagtgctctcggcgttg
gtgaccggcgacagcctggagcggcttcgaagagggctggcggctggaaccagcaatctg
gactcccctactcaatctacggaccagctgctgcccccgggaggtggccgaggccgggaa
gtactggacttggaagagacagacctggaccttttcagagctgctttctcttccaagcca
caagctctggccacaccgagcaaggatgagcgtgggaaaagaaagaagaaaggcaagggg
ttagggaagaagagagacccatgtcttcggaaatacaaggatttctgcatccatggagaa
tgcaaatatgtgaaggagctccgggctccctcctgcatctgccacccgggttaccatgga
gagaggtgccatgggctgagcctcccagtgaaaaatcgtttatatacctatgatcacacg
accatccttgttgtggtggtcgtggtgctgtcatccgtctgtctgctggtcatcgtgggg
cttctcatgttttggtaccacaggagaggaggttatgacgtggaaaatgaagagaaagtg
aaattgggcatgactacgtcccactga

DBGET integrated database retrieval system