KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074944Help
Entry
103074944         CDS       T03090                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00500  Starch and sucrose metabolism
lve01100  Metabolic pathways
lve04151  PI3K-Akt signaling pathway
lve04152  AMPK signaling pathway
lve04910  Insulin signaling pathway
lve04922  Glucagon signaling pathway
lve04931  Insulin resistance
Module
lve_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103074944 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103074944 (GYS2)
   04152 AMPK signaling pathway
    103074944 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103074944 (GYS2)
   04922 Glucagon signaling pathway
    103074944 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    103074944 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lve01003]
    103074944 (GYS2)
Enzymes [BR:lve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     103074944 (GYS2)
Glycosyltransferases [BR:lve01003]
 Polysaccharide
  Storage polysaccharide
   103074944 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 103074944
NCBI-ProteinID: XP_007449430
UniProt: A0A340WR38
LinkDB All DBs
Position
Un
AA seq 701 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEVGLLVEDLLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLLGPYFEHNMKTQVEECEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIS
YSARNLDKWKGDLWEACNVGIPYHDQEANEILIFGSLTAWFLKEVTDHADGKHVIVQFHE
WQAGTGLILSRARKLPIATVFTTHATLLGRHLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVITPNGLNVKKFSAVHEFQNLHAMYK
ARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLKMHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILD
RDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKVILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPTAYGIYIVDRRFRSLDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARHLTLSRAFPDKFHTETTSPPMTEGFKYPRPSSVPPSPSGSQVSSPQSSDVED
ENEDERYDEEEEAERDRLNIKSPLSLNHVPRGKKLHGEYKN
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatccctatctgtgacatccctgggtgggcttccccggtgggaagtc
ggactccttgtggaggatttactgctctttgaagtcgcttgggaagtgaccaataaagtt
ggtggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatggggagac
aattactttctgcttggtccatattttgagcataatatgaagactcaggtagaagaatgt
gaacctgtaaatgatgctgtgagaagagcagtggacgcaatgaacaaacatggctgccag
gtgcactttggaagatggctcatagaaggcagtccttacgtggtgctctttgacataagc
tattcagctcggaacctggacaagtggaaaggtgacctctgggaagcatgcaatgttggt
atcccttatcacgaccaggaagccaatgaaatactgatatttggatcgttaactgcctgg
ttcttgaaagaggtgacagatcatgccgatgggaaacacgtcattgtccaattccatgaa
tggcaggctgggactggactgattctttctcgagctcggaaacttccgattgctacagtc
tttaccactcacgccacactgcttgggaggcatctctgtgcagcaaacatcgatttctac
aaccatcttgataagtttaacatagacaaagaggctggggaaaggcagatttatcaccgg
tattgcatggagcgtgcctcagtccattgtgctcatgtattcaccactgtttctgaaata
acagcaatagaggcagaacacatgctgaagagaaagcctgatgtaattactccaaatggc
ttgaatgttaagaaattttcagcagtacatgagtttcaaaatctccatgccatgtacaag
gccaggatccaagattttgttcgaggtcatttctatggtcacctggactttgatcttgaa
aaaacgttgttcctcttcattgctgggaggtatgagttttcaaacaaaggagctgacatc
ttcctagaatccttatccaggctaaatttcctattgaaaatgcataaaagtgacgtcact
gtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctgaaa
ggccaggcagtgcgaaaacagctatgggacactgcacattctgtgaaggaaaagtttgga
aagaaactgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggat
cgagacgatctgacaattatgaaaagagccatattttcaactcagcggcaatctttgccc
ccagtgacgactcacaacatgattgatgactccaccgatcccatcctcagcaccattaga
aggatcgggcttttcaacagccgtacagacagagtcaaggtgattttgcacccagagttc
ctatcctccaccagccccttgttacccatggattatgaagagtttgtccgaggttgtcat
cttggagtatttccatcatactatgaaccctggggttatactccagccgaatgcactgtg
atgggtatccccagtgtgaccaccaacctctccggctttggctgtttcatgcaggagcat
gtggctgatcccacagcatatggtatttacatcgttgacaggcgattccgctcactggat
gattcttgcaatcagctgactcagtttctctatggattttgcaaacagtcacgccgccag
aggattattcagaggaaccgaaccgagaggctttcagaccttctggattggagatactta
ggcagatattaccagcatgccaggcacctgacgttaagcagagcttttccagataaattc
cacacggaaaccacatcgcccccaatgacagaagggtttaaatatcccaggccttcctca
gtaccaccttctccttcaggatctcaggtctctagtcctcagagcagcgatgtggaggat
gagaatgaggatgaaagatacgatgaggaagaggaggctgaaagggatcggttaaatatc
aagtcgccattgtctctgaatcacgttcctcgcgggaagaagctgcatggcgaatacaag
aactga

DBGET integrated database retrieval system