KEGG   Lipotes vexillifer (Yangtze River dolphin): 103074995
Entry
103074995         CDS       T03090                                 

Definition
(RefSeq) ferulic acid decarboxylase 1-like
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
SSDB
Motif
Pfam: UbiD
Other DBs
NCBI-GeneID: 103074995
NCBI-ProteinID: XP_007456654
UniProt: A0A340XBT5
LinkDB
Position
Un
AA seq 488 aa
MQYRDLRDFIRGLEQRGELKRIQVPISPVLEMTEVCDRTLRAKGPALLFEKPTGFDIPVL
GNLFGTPERVAMGMGAESVDELREIGKLLAFLKEPEPPKGLKDAWSKLPIFKKVVSMAPK
VVKDAVCQEVVLEGEDVDLGALPIQHCWPGDVAPLITWGLTVTRGPNKDRQNLGIYRQQV
IGRNKVIMRWLSHRGGALDYREWCEKNPGQPFPVAVALGADPATILGAVTPVPDTLSEYA
FAGLLRGNRTELVKCRGSNLQVPATAEIILEGVILPGEMAPEGPYGDHTGYYNEVDSFPV
FTVERITHRQKPIYHSTYTGRPPDEPAILGVALNEVFVPILQKQFPEIVDFYLPPEGCSY
RMAVVTMKKQYPGHAKRVMLGVWSFLRQFMYTKFVIVTDDDINARDWNDVIWAITTRMDP
KRDTVMIDNTPIDYLDFASPVSGLGSKMGLDATHKWPGETTREWGRVIVKDEAVTRRIDE
LWDQLGID
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgcagtatcgcgacttgcgcgacttcattcgtggcctggaacagcgcggcgagctcaag
cgcatccaggtcccgatctccccagtgctggaaatgaccgaggtctgcgatcgcacgctg
cgtgccaaaggccctgcgctgttgttcgaaaagccgaccggcttcgacattcccgtgctg
ggcaacctgttcggcacgcctgagcgggtggccatgggcatgggtgccgagtcggtcgat
gagctgcgcgagatcggtaagcttctggcgtttctcaaggagcctgagccccccaaaggg
ctcaaggacgcctggtccaagctgccgatcttcaagaaagtggtatcgatggcgccgaag
gtggtcaaggacgccgtttgccaggaagtggtgctcgaaggagaggacgtggaccttggc
gcattgccgattcagcattgctggccgggcgatgtggcaccgctgatcacctggggcctg
accgtcacgcgcggtccgaacaaggaccgccagaacctgggcatctaccggcagcaagtg
attggccgcaacaaagtgatcatgcgttggctcagccaccgtggcggcgccctggactac
cgtgagtggtgtgaaaaaaatcccggccagccgttcccagtggccgtggcgttgggggca
gaccctgccactatcctgggtgcagtgaccccagtgcccgatacgctttccgaatacgcc
ttcgcgggcctgttgcggggtaatcgcactgagctggtcaagtgccgcggcagcaatctg
caggtgccggccacggccgagatcattctcgaaggggtaatcctcccgggcgagatggcg
cctgaaggcccctatggggaccacaccggttactacaacgaagtggacagtttcccggtg
ttcaccgtcgagcgcatcacccaccggcaaaagcctatctatcacagcacctacaccggt
cggccgccggatgaaccggcgatccttggcgtggcgctgaacgaagtgttcgttccgatc
ctgcagaaacagttcccggaaatcgtcgatttctacctgccaccggaggggtgctcctac
cgcatggcggtggtgaccatgaagaagcagtacccggggcatgccaagcgcgtgatgctg
ggtgtgtggtcgttcctgcgacagttcatgtacaccaagttcgttatcgtgaccgacgac
gacatcaacgcccgcgactggaacgacgtgatctgggccatcaccacacgcatggacccc
aagcgtgatacggtgatgatcgacaacacgccgatcgactacctggactttgcctctcca
gtgtcggggctgggatcgaaaatgggcctggatgccacgcacaagtggccgggcgagact
acacgcgagtgggggcgggtcatcgtcaaggacgaagccgtcacccggcgtatcgatgag
ctgtgggatcagttgggaatagattga

DBGET integrated database retrieval system