KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075027Help
Entry
103075027         CDS       T03090                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00250  Alanine, aspartate and glutamate metabolism
lve00410  beta-Alanine metabolism
lve00430  Taurine and hypotaurine metabolism
lve00650  Butanoate metabolism
lve01100  Metabolic pathways
lve04727  GABAergic synapse
lve04940  Type I diabetes mellitus
Module
lve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    103075027 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103075027 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103075027 (GAD1)
   00430 Taurine and hypotaurine metabolism
    103075027 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    103075027 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    103075027 (GAD1)
Enzymes [BR:lve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103075027 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 103075027
NCBI-ProteinID: XP_007446408
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCESSDRDGRFQRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAIPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYIPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSQKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVLDSPERREKLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVVSNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaacgcgggagcggaccccaat
actaccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctgaagatctgtggcttcttgcaaaggaccaacagcctggaagagaag
agcaggcttgtgagcgccttcaaggagaggcagtcctccaagaatctgctttcctgtgaa
agcagcgacagggatggccgcttccagcgcacagagaccgacttctccaacctgtttgct
cgagatctgcttccggctaagaatggggaggagcaaactgtgcagttcctgctggaggtg
gtagacatactcctcaactacgtccgtaagacattcgatcgctccaccaaggtgctggac
ttccaccacccccaccagctgctggaaggcatggagggcttcaacctggaactctctgac
caccctgagtccctggagcagatcctggttgactgcagagacaccctgaaatatggcgtc
cgcacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtgtttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggcggctcgctataagtacttcccggaagttaagacaaagggcatggcggccataccc
aagctggtcctcttcacctcagaacacagtcactattccataaagaaagctggggctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaagggatacattcctctgtat
gtcaatgcaactgccggcacgactgtttatggtgcttttgatcccatacaggagattgca
gatatatgtgagaaatacaacctctggctgcatgttgatgctgcctggggtggcgggctg
ctcatgtctcagaagcaccgccataaactcagcggcatagaaagggccaactcagtcacc
tggaatcctcataagatgatgggcgtgctgttgcagtgctccgccatcctggtcaaggaa
aagggtatcctccaaggatgcaaccagatgtgtgcagggtacctcttccagccagacaag
cagtatgacgtctcctacgacactggggataaagccattcagtgtggccgccatgtggac
atcttcaagttctggctgatgtggaaagcaaagggcacagtgggctttgaaaatcagatc
aacaaatgcttggagctggcagaatacctctatgccaagattaaaaacagagaggaattt
gagatggtttttgatggtgagcctgagcacacgaatgtctgtttctggtatattccacaa
agcctcaggggcgttctggatagccctgagcgacgggaaaaactacacaaggtggccccg
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcgtctccaacccagccgctacccagtctgatatc
gacttcctcattgaggaaatagagaggctgggccaggatctgtaa

DBGET integrated database retrieval system