KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075672Help
Entry
103075672         CDS       T03090                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve01524  Platinum drug resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04066  HIF-1 signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04510  Focal adhesion
lve04520  Adherens junction
lve04530  Tight junction
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05215  Prostate cancer
lve05219  Bladder cancer
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103075672 (ERBB2)
   04012 ErbB signaling pathway
    103075672 (ERBB2)
   04066 HIF-1 signaling pathway
    103075672 (ERBB2)
   04020 Calcium signaling pathway
    103075672 (ERBB2)
   04151 PI3K-Akt signaling pathway
    103075672 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103075672 (ERBB2)
   04520 Adherens junction
    103075672 (ERBB2)
   04530 Tight junction
    103075672 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103075672 (ERBB2)
   05206 MicroRNAs in cancer
    103075672 (ERBB2)
   05205 Proteoglycans in cancer
    103075672 (ERBB2)
   05230 Central carbon metabolism in cancer
    103075672 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103075672 (ERBB2)
   05226 Gastric cancer
    103075672 (ERBB2)
   05219 Bladder cancer
    103075672 (ERBB2)
   05215 Prostate cancer
    103075672 (ERBB2)
   05213 Endometrial cancer
    103075672 (ERBB2)
   05224 Breast cancer
    103075672 (ERBB2)
   05223 Non-small cell lung cancer
    103075672 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103075672 (ERBB2)
   01524 Platinum drug resistance
    103075672 (ERBB2)
   01522 Endocrine resistance
    103075672 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103075672 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103075672 (ERBB2)
   04090 CD molecules [BR:lve04090]
    103075672 (ERBB2)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103075672 (ERBB2)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103075672 (ERBB2)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   103075672 (ERBB2)
CD molecules [BR:lve04090]
 Proteins
  103075672 (ERBB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 103075672
NCBI-ProteinID: XP_007465231
UniProt: A0A340XV51
LinkDB All DBs
Position
Un
AA seq 1255 aa AA seqDB search
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQEIQEVQGYVLIAHNRVSQVPLQRLRIVRGTQLFEDNYALAVLDNG
DLLESATSAARAALGGLQELQLRSLTEMLKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LMLIDTNRSRACPPCSPACKAPRCWGESSKDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDRASNTAPLQPEQLRVFESLEEITGYLYISAWPDSLP
DLRVFQNLRVIRGRILHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEVECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQQC
VEECRXLLRLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACTHYKDPPFCVARC
PSGVKPDLSFMPIWKFADEEGMCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLLVVVGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPTSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGSGGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDSSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPRPPPRPAGSTLERPKTLSPGKNGVVKDIVAFGAAVENPEYLAPR
GRAAPQSHSSPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDMPV
NT seq 3768 nt NT seq  +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctgccggccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggtaacctg
gagctcacctacctgcccgctaatgccagcctctccttcctgcaggagatccaggaggtg
cagggctacgtgctcatcgctcacaaccgagtgagtcaggtccccctgcagaggctgcgg
attgtgcgaggcacccagctgttcgaggacaactatgccctggccgtgctggacaatgga
gaccttctcgaaagtgccacgtctgctgcacgcgctgctctgggagggctgcaggagctg
cagctgcgaagcctcacagagatgctgaagggaggggtcttgatccagcggaacccccag
ctctgccaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcatgctgatagacaccaaccgctcacgggcctgcccaccctgttctccagcttgtaaa
gctccccgctgctggggagaaagttccaaggactgtcagagcttgacgcgaaccgtctgt
gccagcggctgtgcccgctgtaagggcccgcagcccactgactgctgccacgagcagtgt
gctgccggctgcacgggccccaagcactctgactgtctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttataccttcggcgccagctgcgtgaccgcctgtcct
tacaactacctgtccacggacgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgagggggaccgagcctccaacactgcccccctacagcctgagcagctcagagtattt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgccg
gacctccgcgtcttccagaatctgcgagtaatccggggacgaattctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatccgctggctggggctgcgctcgctgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggtcgagtgcgtgggcgagggcctggcctgctacccgctgtgtgcccacgggcactgc
tggggtccagggcccacccagtgcgtcaactgcagccagttccttcggggccagcagtgc
gtggaagaatgccgnnctctcctcaggctcccccgggagtacgtgaaggacaggtactgt
ctgccgtgccaccctgagtgtcagccccagaatggctcagtgacctgctttggctcggag
gctgaccagtgtgtggcttgcacccactacaaggatcctcccttctgcgtggctcgctgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagtttgcagatgaggag
ggcatgtgccagccgtgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctgtgacgtccatcattgccgctgtggtgggc
attctgctgctcgttgtcgtggggctggtcttcggcatcctcatcaagcgacggcggcag
aagatccggaagtatacgatgcggaggctgctgcaggagacagagctggtggagcccctg
acaccgagcggagcgatgccaaatcaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcaccgtctacaagggcatctggatc
cccgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtagggtcccca
tacgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgggagcaccgcgggcgcctgggctcccag
gacctnctgaactggtgtgtgcagattgccaaggggatgagctacttggaggatgtgcgg
ctcgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
attacagacttcgggctggctcggctgctggacattgatgagacagagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggcgcc
aaaccttacgatgggatcccagcccgggagatccctgacctcctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaagacttgggccctaccagccccttg
gacagcaccttctaccgctcactgctggaggatgatgacatgggggacctggtggatgct
gaggagtacctggtaccccagcaaggcttcttctgcccagaccctgccccgggctctggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctgggtctggagccctcggaggaggagccccccaggtctccgctggcaccttccgaaggg
gccggctctgatgtgtttgacggtgacttgggaatgggggcagccaaggggctgcagaac
ctcccccaacatgactccagccctctacagcggtacagcgaggaccccacagtaccgctt
cctcccgagaccgatggctacgttgcccccctgacctgcagcccccagcccgaatatgtg
aaccagccagaggttcggccacagcccccctcacccctagagggccctcggcctcctcct
cgacctgccggttccactctggaaaggcccaagactctctcccctgggaagaatggggtt
gtcaaagacattgttgcctttggggctgccgtggagaaccccgagtacttggcgccccgg
ggcagggctgcccctcagtcccactcttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggctctccacccagcacctttgaagggacc
cctacagcagagaaccctgagtacctgggtctggacatgccagtatga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078350Help
Entry
103078350         CDS       T03090                                 

Gene name
ERBB4
Definition
(RefSeq) v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04151  PI3K-Akt signaling pathway
lve05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103078350 (ERBB4)
   04012 ErbB signaling pathway
    103078350 (ERBB4)
   04020 Calcium signaling pathway
    103078350 (ERBB4)
   04151 PI3K-Akt signaling pathway
    103078350 (ERBB4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103078350 (ERBB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103078350 (ERBB4)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103078350 (ERBB4)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103078350 (ERBB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like Haspin_kinase APH Kinase-like DUF3951
Motif
Other DBs
NCBI-GeneID: 103078350
NCBI-ProteinID: XP_007470071
UniProt: A0A340Y8S3
LinkDB All DBs
Position
Un
AA seq 1308 aa AA seqDB search
MKLATGLWVWVSLLVATGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYTDTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCNGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
VNQRIVIRDNRKAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRHFSRGRTCIESCNLYD
GEFREFENGSICVECDPQCEKMEDGILTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCSGPTSHDCIYYLWTGHSTLPQHARTPLIAAGVIGG
LFIMVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVPMP
YRATTSTIPEAPVAQGATAEIFDDSCCNGTLRKSVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASHGPPKAED
EYVNEPLYLNTFANTLGNAEYLKNNVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV
NT seq 3927 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggcgacaggactgtgggtctgggtgagccttctcgtggcgacggggaccgtc
cagcccagcgcttctcagtcagtgtgcgcaggaacagagaataagttgagttctctctct
gacctggaacagcagtaccgagccttgcgcaaatactatgagaactgtgaggtagtcatg
ggcaacctggagataaccagcatcgagcacaaccgggacctctcttttctgcggtctata
agagaagtcacaggctatgtgttggtggctcttaatcagtttcgctatctgcctctggag
aatttacgcattattcgtgggacaaaactttatgaagatcgatatgccttggcaatattt
ttaaactacagaaaagatggaaactttggacttcaagaacttggattgaagaacttgact
gaaatcctaaatggtggagtctatgtagaccagaacaagtttctttgttatacagacaca
attcattggcaagatattgttcggaatccatggccttccaacctgactctggtgtcaaca
aatggtagctcaggatgtggacgttgccataagtcctgcaatggccgatgctggggaccc
acagaaaatcattgtcagactttgacaaggactgtctgtgcagaacagtgtgatggcaga
tgctatggaccctacgttagtgactgctgtcaccgagaatgtgctggaggctgctcggga
cctaaggataccgactgctttgcctgcatgaacttcaatgatagtggagcatgtgttact
cagtgtccacaaactttcgtctacaatccaacaacctttcaactggagcataacttcaat
gcaaaatacacctatggagcattttgtgtcaagaagtgcccacataacttcgtggtcgat
tccagttcctgtgtgcgtgcctgccctagttccaagatggaagtagaagaaaatgggatt
aaaatgtgtaaaccttgtactgacatttgcccaaaagcttgtgatggcattggcacagga
tcactgatgtcagctcagaccgtggattctagtaacattgacaaattcataaactgcacc
aaaatcaatgggaatttgatcttcctagtcactggtattcatggggacccttacaatgca
attgaagccatagacccagagaaactgaacgtgtttcggacagtccgagagataacaggg
ttcttgaacatacaatcatggcccccaaacatgactgacttcagtgttttttctaacctg
gtgaccattggtggaagagtactctatagtggcctttccttgcttatcctcaagcaacag
ggcatcacttctctgcaattccaatccctgaaggaaatcagtgcaggaaacatctatatc
actgacaacagcaacctgtgttattatcataccattaactggacaacgctcttcagcaca
gtcaaccagagaatagtgatccgggacaacaggaaagctgaaaactgtactgctgaagga
atggtgtgcaaccatctctgttcaaacgatgggtgttggggacctgggccagaccagtgc
ctgtcgtgccgtcacttcagcaggggaaggacctgcatagagtcttgtaacctctatgac
ggtgaatttcgggagtttgagaatggctccatctgtgtggagtgtgacccccagtgtgag
aagatggaagatggtatcctcacatgccatggaccgggacctgacaactgtacaaagtgc
tcccattttaaggatggcccgaactgtgtggaaaaatgtccagatggcttacagggggca
aacagtttcattttcaagtatgctgatcaggatcgggagtgccacccatgccatccaaac
tgcacccaagggtgtagcggtcccactagtcatgactgcatttactacctttggacgggc
cattccactttaccacaacatgctaggactcctctaattgcagccggagtcattggcggg
ctcttcatcatggtcatcgtgggtctaacatttgcagtttatgttagaaggaagagcatc
aaaaagaaaagagccttaagaagattcctggaaacagagttggtagaacccttaacaccc
agtggtacggcgcctaatcaagctcaactacgtattttgaaagaaactgagctcaaaaga
gtaaaagtacttggttcaggtgcttttggaactgtttataaaggtatttgggtccctgaa
ggagaaacagtgaagattcctgtggctattaagattcttaatgaaacaactggtcccaaa
gccaatgtggagtttatggatgaagctctgatcatggcaagtatggaccatccacactta
gtccggttattgggtgtgtgtctaagcccaaccattcagctggttacacagcttatgccc
catggctgcctgttggattatgtccatgaacacaaggataacattggatcccagctattg
cttaattggtgtgtccagatagctaagggaatgatgtacctggaagaaagaaggcttgtt
catcgggatttggcagcccgtaatgtcttagtgaaatctccaaaccatgtaaaaatcaca
gattttggactagccaggctcttggaaggtgatgaaaaagagtataatgctgatggagga
aagatgccaattaaatggatggctttggagtgtatacactatagaaaattcacccatcag
agtgacgtttggagctatggagtcactatatgggaactgatgacctttggaggaaaaccc
tatgatggaattccaaccagagaaatccccgatttgttagagaaaggagaacgtttgccc
cagcctcccatctgcactattgatgtttatatggtcatggtcaaatgttggatgattgat
gctgacagtagacctaaatttaaggaactggctgctgaattttcgaggatggctcgagac
cctcaaagatacctagttattcagggtgatgatcgtatgaagcttcccagtccaaacgac
agcaagttctttcagaatctcttggatgaagaggatttagaagatatgatggatgctgag
gaatatctggtccctcaggctttcaacatcccacctcccatctatacttccagagcaaga
atcgactcaaataggagtgaaattggacacagccctcctcctgcctacacccccatgtca
ggaaaccagtttgtgtaccgagatgggggttttgctgcagagcaaggagtgcccatgccc
tatagggcaaccaccagcacgatcccagaagccccagttgctcagggggctactgccgag
atttttgatgactcctgctgtaatggcaccttacgcaagtccgtggcaccccacgtccaa
gaggacagcagcacgcagaggtacagcgctgaccccacagtgtttgccccagaacggagc
ccacgaggagagctggatgaggaaggttacatgacccctatgcgagacaaacccaaacaa
gaatacctgaaccctgtggaagagaacccttttgtctctcggaggaaaaatggagacctt
caagctttggataatcccgaatatcacagtgcttcccatggtccacccaaggcagaggat
gagtatgtgaatgagccactgtacctcaacacctttgccaacaccttggggaacgctgaa
tacctgaagaacaacgtactgtctgtgccagagaaggccaagaaagcattcgacaaccct
gactactggaaccacagcctgccacctcggagcacccttcagcacccagactatctgcag
gagtacagcacaaaatatttttataaacaaaatggaaggatccggcctattgtggcagag
aatcctgaatacctctctgagttctcgctgaagccaggcactgtgctgcctcctccgccc
tacagacaccggaatactgtggtgtaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087241Help
Entry
103087241         CDS       T03090                                 

Gene name
ERBB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04020  Calcium signaling pathway
lve04151  PI3K-Akt signaling pathway
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103087241 (ERBB3)
   04012 ErbB signaling pathway
    103087241 (ERBB3)
   04020 Calcium signaling pathway
    103087241 (ERBB3)
   04151 PI3K-Akt signaling pathway
    103087241 (ERBB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103087241 (ERBB3)
   05205 Proteoglycans in cancer
    103087241 (ERBB3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103087241 (ERBB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103087241 (ERBB3)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103087241 (ERBB3)
Protein kinases [BR:lve01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103087241 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like SKG6
Motif
Other DBs
NCBI-GeneID: 103087241
NCBI-ProteinID: XP_007467802
UniProt: A0A340Y622
LinkDB All DBs
Position
Un
AA seq 1338 aa AA seqDB search
MRANGALQVLGFLLSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRFTQLTEILSGGVYIEKNDKLCHMDTVDWRDIVRDRDAEIVVKDNG
RTCPPCHEVCKGRCWGPGPEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRLFNDSGACVRQCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKICEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGLRSLKEISAGRIYISANRQLCYHYSLNWTRLLRGPSEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPSQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTTTCNGSGSDACAQCAHFRDGPHCVSSCPFGVLGAKGPI
YKYPDAQNECRPCHENCTQGCKGPELQDCLGQTLVLISKTHLVMALTVVVGLAVIFLILG
STFLYWRGRRIQNKRAMRRYLERGESVEPLDPSEKANKVSARIFKETELKKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLITQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLHSETKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGLPPGAEPPALTNKELEEVELEPELDLDLELEAEEE
NLATTLGSALSLPLGTLPRPRGSQSLVSPSSGYMPMNQGNLGEAAQKSAVRGCSERCHRP
ASLHPAPRGRLASESSEGHVTGSEAELQEKVSMCRSRSRSPRPRGDSAYHSQRHSLLTPV
TPQSPPGLEEEDVNGYVMPDAHLKGTSSREGTLSSVGLSSVLGTEGEDDDDEYEYMNRRR
KCSPSRPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLNPVPTMPNASTTPDEDYEYMN
RRRGGGGPGGDYAAMEACPAAEQGYEEMRAFQGPVHHGPQVHYARLKTLRSLEATDSAFD
NPDYWHSRLFPKANAQRT
NT seq 4017 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgaacggggctctgcaggtgctgggcttcctcctcagcctggcccggggctcc
gaggtgggcaactcgcaggcagtgtgccctgggactctgaatgggctgagtgtgaccggc
gatgccgagaaccagtaccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaacctggagatcgtgctcacaggacacaatgctgacctctccttcctgcagtggatc
cgagaagtgaccggctacgtccttgtggccatgaatgagttctctacgctgccactgccc
aacctccgagtggtgcgggggacccaggtctacgatgggaagtttgccatctttgtcatg
ttgaactacaacaccaactccagccatgctctgcgccagctccgctttactcagctcact
gagattctgtcagggggcgtttacattgagaagaatgataaactttgtcacatggacaca
gttgactggagggacatcgtgcgggaccgagacgccgagatagtggtgaaggacaatggc
aggacctgtcccccctgtcatgaggtctgcaaggggcgatgctggggtcctggaccagaa
gactgccagacactgaccaagaccatctgtgcccctcagtgtaatggtcactgctttggg
ccgaaccccaaccagtgttgccacgacgagtgtgcagggggctgctcgggccctcaggac
acagactgctttgcctgccggctcttcaatgacagtggagcctgtgtacgccagtgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatct
tgtgtcagggcttgtcctcctgacaaaatggaagtagataaaaatggactcaagatatgt
gaaccttgtgggggtctgtgccccaaagcttgtgaggggacgggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttcttatcaccggcctcaatggagacccctggcacaagattcctgctctggac
cctgagaagctcaatgtcttccggacagtgcgggagatcacaggttacctgaacatccag
tcctggcctccccacatgcacaacttcagtgtcttttccaacctgacgaccattgggggc
cgaagcctctacaaccggggcttctcactgttgatcatgaagaacttgaatgtaacatct
ctgggcctccgatccttgaaagaaattagtgctgggcgtatctacataagtgccaatcga
cagctctgctaccactattctttgaactggaccaggctgcttcgggggccttcggaagag
agactggacatcaagcataatcggccccgcagagactgcgtggcagaaggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccccagtcagtgcctatcttgc
cgaaactacagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgtgagtttgcccatgaagctgaatgcttttcctgccacccggaatgccaacccatggag
ggcactaccacgtgcaatggctcgggctctgatgcttgtgcccagtgtgcccattttcga
gatgggccccactgtgtgagcagctgcccctttggagtcctcggtgccaaaggccccatc
tacaagtacccagatgctcagaatgaatgtcggccctgtcatgagaactgcacccagggg
tgtaagggaccagagctacaagactgtttaggccaaacactggtactgatcagcaaaacc
catctggtaatggctttaacagtggtggtaggattggcagtgattttcctgatcctgggc
agcacttttctctactggcgtgggcgccggattcagaataagagggctatgaggcgctac
ttggaacggggtgagagcgtagagcctctggatcccagtgagaaggctaacaaagtctca
gccagaatcttcaaagaaacagagctgaagaagcttaaagtgctgggctcgggcgtcttc
ggaactgtgcacaaaggagtgtggattcctgagggtgaatcgatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcaaagttttcaagctgtgacggaccatatg
ctggccattggcagcctcgaccatgcccacattgtacggctgctgggactgtgcccaggg
tcatctctgcagctcatcactcagtacctgcctctgggctccctgctggatcatgtgaga
caacaccgtggggcactggggccacagctgctgctcaactggggagtccaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcacaggaacctggctgcccgaaatgtg
ctactgaagtcacctagtcaagttcaggtggcagattttggggttgctgacttgctgccc
cctgatgataagcagctactgcacagtgagaccaagactccaattaagtggatggccctc
gagagtatccactttggaaaatacacacaccagagtgacgtctggagctatggagtgaca
gtttgggagctgatgacctttggggcagagccctatgcagggctgcgactggctgaagta
ccagatctgctggagaagggggagcggttggcacagccccagatctgtaccattgacgtc
tacatggtcatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtacctggtcataaagaga
gagagtgggcctggacttccgcctggggcagagccccctgctctaacaaacaaggaactg
gaggaagtagagctggagccagaactagacctagacctggagttggaggcagaggaggag
aacttggcaaccacactaggctctgcccttagcctgccacttggaacacttcctcgccca
cgtgggagccagagccttgtaagtccatcatcgggatatatgcctatgaaccaggggaat
cttggggaggctgcccagaagtctgcagttcgtgggtgtagtgaacggtgccaccgtcca
gcctctctgcacccagcgccacggggacgcctggcatcagagtcatcggagggccatgtg
acaggctctgaggccgagctccaggagaaggtatccatgtgtagaagccggagccggagc
ccacggccacgaggagacagtgcctaccattcccagcgccacagcctgcttactcctgtc
accccacagtccccaccagggttagaggaagaggatgtcaatggttatgtcatgccagat
gcacacctcaaaggtacctcctcccgggaaggcaccctttcttcagtgggtctcagttct
gtcctgggtactgaaggagaagacgacgacgacgagtatgaatacatgaaccggaggaga
aagtgcagtccatctcgtccccctaggccaagttcccttgaggagctgggttatgagtac
atggatgtgggatcagacctcagtgcttccctgggcagcacacagagttgcccgctcaac
ccagtgcccaccatgcccaacgccagcacaactccggatgaagattatgaatatatgaat
cggcgacgtggtggaggaggtcctgggggggattatgcagccatggaggcctgcccagca
gctgagcaagggtatgaagaaatgagagctttccaggggcctgtacaccatggcccccag
gtccattatgcccgcctcaaaaccctacgtagtttagaagccactgactctgcctttgat
aaccccgattactggcatagccggcttttccccaaggctaatgcccagagaacataa

DBGET integrated database retrieval system