KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075844
Entry
103075844         CDS       T03090                                 

Gene name
MAP3K4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4
  KO
K04428  mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103075844 (MAP3K4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103075844 (MAP3K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103075844 (MAP3K4)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103075844 (MAP3K4)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE11 family
   103075844 (MAP3K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 103075844
NCBI-ProteinID: XP_007457647
UniProt: A0A340XC38
LinkDB
Position
Un
AA seq 1644 aa
MLPPVRPRSSKEVDAREADAHWLLPLRSPPALRLSPPECACCLSCEKLHSGCANRQECAL
GDSACKNSESDPEDFSDETNTENLYGTSPPSTPRQRKRLSTKHRRNNVGRPTSQANVKEK
MNAANQPPHKDTGKTVENVEEYSYKQEKKVRAALRTTEPDHKKNVQCSFMLDPVGGSLPK
KSIPDVDLNKPYLSLGCSNAKLPVSVPMPIARTARQTSRTDCPADRLKFFETLRLLLKLT
SVSKKKDREQRGQENTSAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIIN
EILTFKVNYGSFAFVRNGASFNGTLVEGQCRAPHGTKVVGYPTYHEHLQRQRVSFEQVKR
IMELLEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGI
KNLSDIGWPVFEIPSPRPSKGNEPEDEGEDTEGELKELESSTDESEGEQISDPRVPETRQ
PVDSSFNIQSPDCVTKKLERLESEDDSVGWGTPDCSTEAGFSRHCLTSIYRPFVDKALKQ
MGLRKLILRLHKLMDGSLQRARVALVKSDRPVEFSEFPDPTWGSDYVQLSRTPPSSEQKC
SAVSWDELKSMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECK
EVLKGGLLMKQYYQFMLHEVLEHLEETDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLP
QASHSLKNLLEEEWNFTKEIIHYIRGGEAQAGKLFCCYSSALPARPIELIPPAGFDLAPQ
TPAPLAVTFCPVRRMLLKSTGSFLESGLQESCAEFWTSADDSSASDEIRRSVIEISRALK
ELFHEARERASKALGFAKMLRKDLEIAAEFILSAPVRDLLDVLKSKQYVKVQIPGLENLQ
VFVPDALAEEKSIILQLLNAAAGKDCSKDSYELLIDAYLLLTKQSDRAQDSEGSWATWEA
QPVKIVPQVETVDTLRSMQVDNLLLVVMESAHLIIHRKAFQQSTEGLMTLRQEQTSSQPV
IAKALQQLKNDALELCNRISDAIDRVDHMFTSEFDAEVDESESATLQQYYREAMIQGYNF
GFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTKCESGRGTRPRWATQGFDFLQAI
EPAFISALPEDDFLSLQALMNECIGHVIGKPHSPITGLYLAIHRNSPRPVKVPRCHSDPP
NPHLIIPTPEGFSTRSAPADTRSLSSPAAATVTATAASGRPGPSGSDSAPPKPISSAHET
RGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPKGDSSGSTRRSWELRTLISQT
KDTASRQGPIEAIQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQ
RGNKIGEGQYGKVYTCINVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVR
YFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYSKQITVAINVLHEHGIVHRDI
KGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGR
AADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLSPEGKDFLSHCLES
EPRMRWTASQLLDHSFVKVCTDEE
NT seq 4935 nt   +upstreamnt  +downstreamnt
atgctacctcccgttcgcccccgctcaagtaaagaggtagacgctcgtgaagcagatgcg
cactggctgttgccccttcgttctcctcctgccctccgtttgtctccccccgagtgtgcc
tgctgtctctcctgtgagaaactgcattcgggctgtgcaaacagacaagagtgcgcattg
ggagattcagcttgtaagaattctgagtctgatcctgaggacttttcagatgaaacaaat
acagagaacctttatggtacctctccccccagcacacctcggcagaggaagcgcctgtca
accaaacacaggaggaataatgtagggaggcccaccagtcaagctaatgtgaaagaaaaa
atgaacgcagcaaaccaacctccacataaagacactggaaaaactgtggagaatgtggaa
gaatacagctataagcaggagaaaaaggtccgagcagctcttaggacgacggagccggat
cataagaagaacgtgcagtgctcgttcatgttggacccagtgggtgggtctttgcccaaa
aaatcaattccagacgtggatctcaataagccttacctcagtcttggctgcagcaatgct
aagcttccggtgtctgtgcccatgccgatagccagaactgcacgccagacttctaggact
gactgtccagcagatcgcttaaaattttttgaaactctgcgacttctactaaagcttacc
tcagtctcaaagaagaaggacagggagcaaagaggacaggaaaatacgtctgctttctgg
tttaaccgatctaatgaactgatctggttagagctacaagcctggcatgcaggacggacc
attaacgaccaggacctctttttatacacagcccgtcaagccatcccagatattatcaat
gaaatccttactttcaaagttaattatgggagctttgcctttgttagaaatggagctagt
tttaatggtactttggtagaagggcagtgcagagcccctcatgggacaaaggttgtgggt
tacccaacatatcatgagcatctccaacgccagagggtgtcatttgagcaggtcaaacgg
ataatggagctgctggagtacatagaggcactttatccatcgttgcaggctcttcaaaag
gactacgaaaaatacgctgcaaaggacttccaggacagggtgcaggcgctctgtttgtgg
ttaaacatcacaaaagacttaaatcagaaattaaggattatgggcactgttttgggcatc
aagaatttatcagacattggctggccagtgtttgaaatcccttccccacgaccatccaaa
ggcaatgagcccgaagatgagggtgaggacacagaaggagaattgaaagagttggaaagc
agtacggacgagagtgaaggagaacaaatctctgatccacgggtaccagagaccaggcag
cccgttgacagcagtttcaacatccagtcaccggactgcgtaactaagaagcttgagagg
cttgaatctgaggacgattctgttggctggggaacaccagactgcagcacagaagcaggc
ttcagtagacattgtctgacttctatttatagaccatttgtagacaaagcactgaagcag
atggggttaagaaagttaattttaagacttcacaagctgatggatggttccttgcaaagg
gcacgtgtagcactggtaaagagtgaccgtccagtggagttttctgaatttccggatccc
acgtggggttctgattacgtgcagctgtccaggacgccgccttcctcggagcagaaatgc
agcgctgtctcgtgggatgagctgaagtccatggatttaccctcattcgaacctgccttc
ctggtcctctgtcgagtccttctgaatgtcatacatgaatgtctcaagttaaggttggaa
cagagacctgctggagaaccatctctcttgagtattaagcagctggtgagagagtgtaag
gaggtgctgaagggcggcctcctgatgaaacagtactaccagttcatgctgcacgaggtc
ctggagcacctggaggagaccgactgcaacatcgacgccttcgaggaggatctgcacaaa
atgctgatggtatattttgattacatgagaagctggatccaaatgctacagcagttacct
caagcatctcatagtttaaagaatctgttagaagaagaatggaatttcaccaaagaaata
atccattatatccggggaggggaagcacaggctggcaaacttttctgttgctacagttct
gcattgcctgcaaggcccatcgagctcatacctccagctgggtttgatctcgcgcctcag
acaccagctccgctcgcagttaccttctgccccgtccgacgaatgctgctgaaatctaca
ggaagtttcctagaatctggcttacaggagagctgtgcagagttttggaccagtgccgat
gatagtagtgcttcagatgaaataaggagatctgttatagagatcagtcgagcactgaag
gagctctttcatgaggctagagaaagagcctccaaagcacttggatttgctaaaatgcta
agaaaggacctggaaatagctgcggagttcatactttcagccccagttagagaccttctg
gatgtcctgaaatcaaaacagtacgttaaggtacaaattcctggcttagaaaacttgcag
gtgtttgttccagacgcccttgctgaggagaagagtattattttgcagttactcaacgcg
gccgcaggaaaagactgctcgaaagactcctatgaactgctgatcgacgcctatctgctt
ctcaccaaacagagcgaccgcgctcaggactcagagggcagctgggccacgtgggaggcg
cagcctgtcaaaatcgtgcctcaggtggagactgtcgataccttgagaagcatgcaggtg
gataatcttttactagttgtcatggagtctgcccatctcataattcatagaaaagctttc
cagcagtccactgaaggactcatgaccctacgccaggagcagacatccagtcagcccgtc
attgccaaagctttgcagcagctgaagaatgatgcattagagctttgcaacagaataagt
gatgccattgaccgagtggaccacatgttcacttcagaatttgacgctgaagttgatgaa
tctgaatctgctacgttgcagcagtattatcgagaagccatgattcaagggtacaatttt
gggttcgagtatcataaagaagtcgttcgtttgatgtctggcgagtttagacagaagata
ggagacaagtatataagctttgcccggaaatggatgaattacgtcctgactaaatgtgag
agtggtagaggcacaagacccaggtgggcaactcaaggttttgacttcctgcaagccatt
gaacctgctttcatttcagctttaccagaagatgacttcctgagtttacaagccctgatg
aatgaatgcattggccatgtaataggaaagccgcacagtcctattacaggtttgtacctt
gccattcatcggaacagcccccgtcctgtgaaggtaccacgatgccatagcgaccctcct
aaccctcatctgattatcccaactccagagggattcagcacccggagcgcgcctgcggac
acgcggagcctcagcagccccgccgccgccactgtcactgccaccgccgccagcggtcgc
cccggcccctccggcagcgactctgcgccgcccaaacccatcagcagtgcccatgagacc
aggggttccagcgtccctgagaatgatcgattggcttccatagcggccgaactgcagttt
aggtccctgagtcgtcactcgagccccaccgaggagcgagatgaaccagcgtatccaaaa
ggtgattcaagcgggtcaactcgaagaagttgggaacttcggacacttatcagtcagact
aaggataccgcttccaggcaaggacccatagaagctattcagaagtcagtccgactgttt
gaagaaaagagataccgagaaatgaggagaaagaatatcattggtcaagtgtgtgatacc
cctaagtcttatgacaatgttatgcacgttggcttgaggaaggtgacctttaagtggcaa
agaggaaacaaaattggggaagggcagtatgggaaggtctatacctgtatcaacgtggac
accggtgaactgatggccatgaaggagattcgctttcaacctaatgaccacaaaactatc
aaggaaacggcagacgaacttaaaatcttcgaaggcatcaagcaccccaatctggttcgg
tattttggtgtggagctgcatagggaagaaatgtacatcttcatggagtactgtgacgag
ggtaccttagaggaggtgtcgaggctgggacttcaggagcacgtcatcaggctgtattct
aagcagatcaccgttgcaatcaatgtcctccacgagcatggcatagttcaccgtgacatt
aaaggtgccaacatcttccttacctcatctggactaatcaagctgggagattttggatgc
tcagtaaagctcaaaaacaatgctcagaccatgcctggtgaagtgaatagcacgctgggg
acagcagcatacatggccccagaagtcatcactcgcgccaaaggagaaggccatgggcgt
gcggccgacatctggagtctagggtgcgttgtcatagagatggtgactggcaagagacct
tggcatgaatatgagcacaactttcagattatgtacaaagtgggaatggggcataagcca
ccaatccctgaaagattaagcccagaaggaaaggacttcctttctcactgcctagaaagt
gagcccaggatgaggtggacggccagccagctcctcgaccattccttcgtcaaggtttgc
acagatgaagaatga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076636
Entry
103076636         CDS       T03090                                 

Gene name
MAP3K3
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3
  KO
K04421  mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04722  Neurotrophin signaling pathway
lve04912  GnRH signaling pathway
lve05166  Human T-cell leukemia virus 1 infection
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103076636 (MAP3K3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103076636 (MAP3K3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103076636 (MAP3K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103076636 (MAP3K3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103076636 (MAP3K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103076636 (MAP3K3)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103076636 (MAP3K3)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE11 family
   103076636 (MAP3K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 103076636
NCBI-ProteinID: XP_007456827
UniProt: A0A340X9T5
LinkDB
Position
Un
AA seq 647 aa
MKDLVALQMSRRPRVPGYETMKNKETGHPNRQKKHNSSSSALLNSPTVTTSSCAGASEKK
KFLSDVRIKFEHNGERRIIAFSRPVRYEDVEHKVTTVFGQPLDLHYVNNELSILLKNQDD
LDKAIDILDRSSSMKSLRILLLSQDRNHTSSPPHSGVSRQVRIKASQSAGDINTIYQPPE
PRSRHLSVSSQNPGRSSPPPGYVPERQQRIARQGSYTSINSEGEFIPETSEQCMLDPLSS
AENSLSGSCQSLDRSADSPSFRKSRMSRAQSFPDNRQEFSERETQLYDKGVKGGTYPRRY
HVSVHHKDYNDGRRTFPRIRRHQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSAD
SENALSVQERNVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDS
PETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAERTLTIFMEYMPGGSVKDQLKAYG
ALTESVTRKYTRQILEGMSYLHSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICM
SGTGMRSVTGTPYWMSPEVISGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKI
ATQPTNPQLPSHISEHGRDFLRRIFVEARQRPSAEELLTHHFAQLVY
NT seq 1944 nt   +upstreamnt  +downstreamnt
atgaaggatctggtggccctccagatgagccgacgtccccgggtgcctggatatgagacc
atgaagaacaaagaaacgggtcacccaaataggcagaaaaaacacaacagcagcagctca
gcccttctgaacagccccacagtaactacaagctcatgtgcaggggccagtgagaaaaag
aaatttttgagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagca
ttcagccggcctgtaagatacgaagatgtggagcacaaggtgacgacagtgtttgggcag
cctcttgatctacattacgtgaacaatgagctctccatccttctgaagaaccaagatgat
cttgataaagcaattgatattttggatagaagctcaagcatgaaaagccttaggatattg
ctgctgtcccaggacagaaaccataccagttcccctccccactccggggtgtccaggcag
gtgcgaatcaaagcttcccagtctgcgggagacataaataccatctaccagccccctgaa
cccaggagcaggcacctctctgtcagctcccagaaccccggccgaagctcgcctccccct
ggctacgtgcccgagcggcagcagcggattgcccgacaggggtcctacaccagcatcaac
agcgagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagt
gctgaaaattccttgtcaggaagctgccaatccttggacaggtccgcagacagcccatcc
ttccggaaatcgcgaatgtcccgagcccagagcttcccagacaacagacaggaattctcg
gaacgggaaactcagctctatgacaaaggggtcaaaggtggaacctacccccggcgctac
cacgtgtccgtgcaccacaaggactacaatgacggcagaagaacatttccccgaatacgg
cgtcatcaaggcaacctgttcaccctggtgccctccagccgctccctgagcacaaatggc
gagaacatgggcctggcagtgcagtacctggacccccgagggcgcctgcggagtgcggac
agtgagaatgccctctctgtgcaggagaggaacgtgccaaccaagtctcccagtgccccc
atcaattggcgccgggggaagctcctgggccagggtgcctttggcagggtctatttgtgc
tatgatgtggacacaggacgagaacttgcttccaagcaggtccagtttgacccagatagt
cctgagacaagcaaggaggtgagtgcactggagtgtgagatccagttgctgaagaacttg
cagcacgagcgcatagtgcagtactatggctgcctgcgggaccgtgccgagaggaccctg
accatcttcatggagtacatgccggggggctcagtgaaagaccagttgaaggcctacgga
gctctgacagagagtgtgacccgaaaatacacccggcagatcctggagggcatgtcctac
ctgcacagtaacatgattgttcaccgggacatcaagggagccaacatcctccgagactct
gctgggaatgtgaagctgggggactttggggccagcaagcgcctgcagaccatctgcatg
tcaggcacgggcatgcgctcagtcactggcacaccctactggatgagccctgaggtgatc
agcggtgagggctacggaaggaaggcagacgtgtggagcctgggctgcactgtggtggag
atgctgacagagaaaccaccttgggcagagtatgaagccatggccgccattttcaagatt
gccacccagcccaccaatcctcagctgccctcccacatctctgagcatggccgggacttc
ctgaggcgcatttttgtggaggcccgccagagaccttcggccgaggagctgctcacacac
cactttgcacagctcgtgtactga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083140
Entry
103083140         CDS       T03090                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04540  Gap junction
lve04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083140 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103083140 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083140 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103083140 (MAP3K2)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103083140 (MAP3K2)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE11 family
   103083140 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 103083140
NCBI-ProteinID: XP_007461365
UniProt: A0A340XQR7
LinkDB
Position
Un
AA seq 620 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKAKSLSPKKQNDVRVKFEHRGEKRILQF
PRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILL
VINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIVGPTSRDRSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQS
YPDNHQEFSDYDNPIFEKFGKGGTYPRRYHVSYHHQDYNDGRKTFPRARRTQGTSFRSPV
SFSPTDHSLSTSSGSSIFTPEYDESRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLG
KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHERIV
QYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMI
VHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYG
RKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDHTRDFLKRIFV
EAKLRPSADELLRHMFVHYH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgatggatgatcagcaagctttgaactcaatcatgcaagatttggctgttcttcataag
gccagtcgaccagcattatccttacaggaaaccagaaaagcaaaatccttatcaccaaaa
aagcagaatgatgtccgagtcaaatttgaacacagaggagaaaaaagaatccttcagttt
cccagaccagttaaactggaagatctgaggtctaaagctaaaattgcctttggacagtct
atggacctacattataccaataatgagttggtgattccattaaccacccaagatgacttg
gacaaagctgtggaactgctggatcgtagtattcatatgaagagcctcaaaatattactt
gtaataaatggaagtacacaggctactaatttagagccattgccatcactagaagatttg
gataacacagtatttggagcagagaggaaaaaaagactttctatagtaggtcccactagt
agagatagaagctccccaccccctggatacattccagatgaattacaccaggttgcccgg
aatgggtcatttaccagtatcaacagtgaaggagagttcattccagagagcatggaccaa
atgctggacccattatctttaagcagccctgaaaattctggctcaggaagttgtccatca
cttgatagccctctggatggagagagctatccaaaatcacgaatgcctagggcccagagc
tacccagataatcatcaggaattttcagactatgataaccctatatttgagaaatttgga
aaaggaggaacatatccaagaaggtatcatgtttcatatcatcatcaagactataatgat
ggtcgtaaaacttttccaagagccagaaggacccaggggaccagcttccggtctcctgtg
agtttcagtcctacagaccactccttaagcactagtagtggaagcagtatctttacccca
gagtatgatgagagtcgaataagaagaaggggaagtgacatagacaatcctactttgact
gtaatggacatcagcccacccagccgctcacctcgtgctccaaccaactggagattgggc
aaactgcttggccagggagcctttggcagggtctacctctgttatgatgttgatacagga
agagaattggctgttaagcaagttcaatttgacccagatagccctgagaccagcaaggaa
gtaaatgcacttgagtgtgaaattcagttgttgaaaaacttgctgcatgagcgaattgtt
cagtattatggctgtttgagggatccccaagaaaaaacactttccatatttatggaatat
atgccagggggttcaattaaagaccaactaaaagcatatggagctcttactgagaatgtg
actaggaaatacacccgtcagattctggagggagtccattatttgcacagtaatatgatt
gttcatagagatataaaaggtgcaaatattctgcgagattcaacaggcaacgtcaaacta
ggagattttggggccagcaaacggcttcaaaccatctgtctttcggggacaggaatgaag
tctgtcacaggcacaccatactggatgagccctgaagtgattagtggagaaggctatggc
agaaaagcagatatctggagcgtgggctgtactgtggtggaaatgctaacggaaaagcct
ccttgggcagaatttgaagcaatggctgccatctttaaaatcgccactcagccgacgaac
cctaagctgccaccccatgtctcagaccatactcgagatttcctcaaacggatctttgta
gaggccaaactgagaccttccgctgatgaacttttaaggcacatgtttgtgcactatcac
tag

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083385
Entry
103083385         CDS       T03090                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04120  Ubiquitin mediated proteolysis
lve04530  Tight junction
lve04622  RIG-I-like receptor signaling pathway
lve04722  Neurotrophin signaling pathway
lve04912  GnRH signaling pathway
lve04935  Growth hormone synthesis, secretion and action
lve05161  Hepatitis B
lve05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103083385 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083385 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103083385 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103083385 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083385 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    103083385 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103083385 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103083385 (MAP3K1)
   05161 Hepatitis B
    103083385 (MAP3K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103083385 (MAP3K1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lve04121]
    103083385 (MAP3K1)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103083385 (MAP3K1)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE11 family
   103083385 (MAP3K1)
Ubiquitin system [BR:lve04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103083385 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD APH Phostensin_N zf-ANAPC11
Other DBs
NCBI-GeneID: 103083385
NCBI-ProteinID: XP_007450819
UniProt: A0A340WUT6
LinkDB
Position
Un
AA seq 1926 aa
MAAAAGNRASSSGFPGAGAANPEAGGGGGALKASSTPTAAAGLLREAGSGGRERADWRRR
QLRKVRSVELDQLPEPPLFLTASPPSSSTSPSPEPADAAAGGSGFQPVAVPPPHGPGEQG
GRGRGGDLGGGRARSMNEPRAPRRASRGSAQRGCTPLAGSPRAPPLTLPASGGAPDLAWG
TGRDGGPGRGLAGEFVIVCRHVTGVRAALRVPVEIRYRGPGWDEGCAPGGGAGARRRKRW
GPRGCDSQSLSAGTGGRAGTKAARPERGRRGLRVDGSVTSVKEVWADRLQMLGGLRSFRT
WGLLLAEWCKSQDRMCQPFSFKAVVTAPRSLSGVVGDRGAGAVLPAPCSCAGRRRLPASR
GRSAVAPAPLEPYCLCATVCVRGTVSGKYFGAKQCTVSPPYLRLQNSQGQHRVVMRMLDP
RSQILLGTYCRWTPKKSLNFSEPHISHLENGNDMNTKVTFLHQMFRGLLSVQAFRVALAF
FDPLPNCLFIECPLCARERAELLFSFGSSGLQGRDMLGFISVQNKGPVKFLHIHVASGEH
GDSPPGEGAFCGLSRTFGTDDRRMSKMWQPVPEELPVCREMENKETLKGLHKMDDRPEER
MIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPIKGDGSEINTLAAESQGEGQASAASS
APKGRRSPSPGSSPSGRTVKSESPGVRRKKVSPVPFQSGRITPPRRAPSPDGFSPYSPEE
TNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCGRGTFCIHLLFVML
RVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHTLSS
SSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECRRNR
EPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTTQQHPLAGSQRRSQESNFNLT
HYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLANGES
TGNSGSNGGSSPSAGAASGSSQTSVSGDVVEACCNVLSMVCADPVYKVYVAALKTLRAML
VYTPCHSLAERIKLQRLLRPVVDTILVKCADVNSRTSQLSISTLLELCKGQAGELAVGRE
ILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAGFYPHTVSTDVS
QIECVFSFRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTAVPHVFSKLLEML
NVSSSTYFTRMRRRLMAIADEVEIAEAIQLGIEDTLNGRHDSFLKASVPNSCPEATENSY
FERTDHLEKTGKGLCATKLSASSEDISDRLASISVGLPSSTTMEQPKPMVQTKGRPHSQC
LNSSPLSHHSQLMFPALSSPSSSAPSVPPGTVTDVSKHRPQGFVPCKIPSASPQTQRKFS
LQFQRNCSENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPSNTSKQGDASKNSMTLDLN
TSSKCDDGFGSSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTT
VTFKSEVAVLSPEKDENDDTYKDDMNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVP
QLQVENGEDIIIIQKDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVGTG
TLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIEWM
AGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRLRI
ADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAK
PPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHP
VFRTTW
NT seq 5781 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcctcgggattcccgggcgccggggcggcg
aacccagaagcgggcggcggcggaggggccctcaaggcgagcagcacacccacggcagcc
gcggggctgctgcgggaggcgggcagtgggggccgcgagcgggcggactggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcccgagccgccgcttttcctc
accgcctcgccgccgtcctcctccacttccccgtcgccggagcccgcggacgcggccgct
ggcgggagcggtttccagcctgtggcggtgccgccgccccacggaccgggtgagcagggc
ggccgggggcgcggtggggacttggggggcgggcgggcgaggtcaatgaatgaaccccgg
gcaccgcgcagagcgtcccggggctccgcgcagcgaggctgcacgccgctcgccgggagc
cctagggcaccccctttgacccttccggcgtcgggcggcgccccggacctggcctggggt
actggacgggatgggggcccggggcggggacttgcgggagagtttgttattgtttgcaga
catgtgacaggcgtgcgagccgcgctgcgagtaccggttgagataaggtaccgggggccg
ggctgggacgaaggctgcgcgcccggtgggggggccggagcgcggcggagaaagcggtgg
ggtccccgcggctgtgacagtcagagtctctcggcaggtaccgggggccgggctgggacg
aaggctgcgcgcccggagcgcggccgcagggggctccgggtggacggctccgtaacgtct
gtcaaagaggtgtgggctgaccggctgcaaatgctcgggggcttgcgatcttttaggacg
tggggtttgcttttggcggagtggtgtaagagccaggaccggatgtgtcagccattcagt
ttcaaagcggtggtgactgctccccgcagcctctccggcgtggttggggaccgcggcgcg
ggtgcggtacttcctgctccgtgcagctgcgcgggccgccgccgactgccggcttccagg
ggacgcagtgctgtggctccggctccgttagagccgtactgcctgtgcgctacggtgtgt
gtaagaggtacagtctcaggaaaatattttggtgccaagcagtgtacagtcagccctcca
tatctgaggttgcagaactcgcaggggcagcacagggtagtgatgaggatgctggacccg
aggagtcagatccttttaggcacttactgtcgctggactccaaagaagtcacttaacttc
tctgaacctcacatttctcatcttgaaaatgggaatgacatgaacactaaagtgaccttc
ctgcaccagatgttcagaggattgctttctgtccaagccttccgggtggctcttgcattt
ttcgaccctcttcctaattgcttgtttatcgaatgtcctctgtgtgccagggaacgtgct
gagttactgttttcattcggctcttcggggttgcagggaagagacatgttagggtttatt
tcagtgcaaaataaaggacccgtgaagtttctgcacatacatgtggcctctggagaacat
ggtgattcaccacctggggagggtgccttttgtggcctgtccaggacatttggcactgat
gatagaagaatgagtaagatgtggcagcctgtcccagaagagctcccagtgtgtcgtgag
atggagaataaagaaactctcaaggggttgcacaagatggacgatcgcccagaagaacga
atgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaatggctggaa
aggagaaacaggagaggccctgtggtggtaaaaccaatccctattaaaggagatggatct
gaaattaataccttggcagctgagtctcaaggagagggccaggcaagcgctgcttcctca
gctcccaaaggccgacgcagtccttcccctggcagctccccatcaggccgcacagtgaaa
tctgaatctccaggagtaaggagaaaaaaagtttccccggtgccttttcagagcgggaga
atcacaccacctcgaagagccccttcaccagatggcttctcaccatacagccctgaggaa
acaaaccgccgtgtaaacaaagtgatgcgggcgaggctgtacttactgcagcaaataggg
cccaactccttcctgattggaggagacagcccagacaataaataccgggtgtttattggg
cctcagaactgcagctgtgggcgtggaacattctgtattcatctgctatttgttatgctc
cgagtgtttcagctagaaccttcagacccaatgttatggaggaaaactttaaagaatttt
gaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatcaaagctcca
tctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcatacattgtcatca
tctagcacttctacatctagttcagaaaacagtataaaagatgaagaggaacagatgtgt
cctatttgcttgttgggcatgcttgatgaagaaagtcttacagtgtgtgaagatggctgc
aggaacaagctgcaccaccactgcatgtcaatttgggcagaagaatgtagaagaaacaga
gaacctttaatatgtcccctttgtaggtctaagtggagatcccatgatttctacagccac
gagttgtcaagccctgtggattccccttcttccctgcgagctgcacagcagcaaaccaca
cagcagcatcccttggctggatcacaacgaaggagtcaagagagcaattttaatcttact
cattatggaactcagcagatccctcctgcttataaagatttagctgagccatggattcag
gtatttggaatggaactcgttggctgcttattttctagaaactggaatgtaagagagatg
gctctcagacgtctttcccatgatgttagcggggctctgctgttggcaaatggggagagc
actggaaattccgggagcaacggcgggagcagcccaagtgctggagctgccagtgggtct
tcccagaccagtgtctcaggagatgtggtggaggcatgctgcaacgttttgtcaatggtc
tgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacgttgagagccatgcta
gtatatactccttgccatagtttggcagaaagaatcaaactgcagagacttctccggcca
gttgtagacaccatcctagtcaagtgtgcagacgtcaatagtcgcacaagtcagctgtct
atatcaacgctattggaattgtgcaaaggccaagcaggagagttggccgttggcagagaa
atacttaaagctggatccattggtattggtggtgttgattatgtcttaaattgtattctt
ggaaaccaaactgaatcaaacaactggcaagaactcctgggccgcctttgtctcatagat
agactgctgttggaatttcctgctggattttaccctcatactgtcagtactgatgtttca
caaattgaatgtgttttttctttcaggtataagaagctgctgtccctcttaacctttgct
ttgcagtccattgataattcccactcaatggttggtaaactctccagaaggatatatttg
agttctgcaagaatggttactgcagtaccccatgtattttcaaaactgttagaaatgctg
aatgtttccagttctacttattttaccaggatgcgtcgtcgtttgatggctattgcagat
gaggtggaaattgctgaggccatccagctgggcatagaagacactttgaatggtcgacat
gacagctttttgaaagcatcagtccctaacagctgtccagaagccacagagaacagttac
tttgagcgcacagaccatttagagaaaactggaaaaggattgtgtgctacaaaattgagt
gccagttcagaggacatttctgaccgactggccagcatttcagtaggacttcctagttca
acaacaatggagcagccaaagccaatggttcaaacaaaaggcagaccccacagtcagtgt
ttgaactcctctcctttatctcaccattcccaactaatgttcccagccttgtcaagccct
tcttcatctgccccatctgtaccacctggcaccgtaacagatgtctctaagcacagacct
caggggtttgttccctgcaaaataccttctgcatctcctcaaacacagcgcaagttttct
ctacagttccagagaaactgttctgaaaacaaagattcagataaactttccccagtcttt
actcagtcaagacccctgccctccagtaatatacacaggccaaagccatctcgacctacc
ccaagtaatacaagtaaacagggagatgcctcaaaaaatagcatgacacttgatttgaac
actagttccaaatgtgatgatggctttggcagcagcagcaatagcagtaatgctgttata
cctagtgacgagacagtgttcaccccagtagaggagaaatgcagattagatgtcaataca
gagctcaactccagtattgaggaccttcttgaagcatctatgccttcaagtgacacaaca
gtaacttttaagtcagaagttgctgtgctgtctcctgaaaaggatgaaaatgatgatacc
tacaaagatgatatgaatcataatcagaagtgcaaagaaaaaatggaagctgaagaagaa
gaagctttagcgattgccatggcaatgtcagcatctcaggatgccctccccatagttcct
caactacaggttgaaaatggagaagacatcatcatcattcaaaaagatacaccagagact
ctaccaggacataccaaagcaaaacaaccttatagagaagacactgaatggctgaaaggt
cagcagataggccttggagcattttcttcttgttatcaggctcaagatgtgggaactgga
actttaatggctgttaaacaggtgacgtatgtcagaaatacatcttctgagcaagaagaa
gtagtagaagcattaagggaggagataagaatgatgagccatctgaaccatccaaacatc
attaggatgttgggagccacatgtgagaagagcaattataatctcttcattgaatggatg
gcagggggatctgtggctcatttgctcagtaaatatggagccttcaaggaatcagtagtt
attaactatactgaacaattacttcgtggcctttcatatctccatgaaaaccagatcatt
cacagagatgtcaaaggtgccaatttgctaattgacagcacaggtcagagactgagaatt
gctgattttggagctgcagccaggttggcatcaaaaggaactggtgcaggagagtttcag
ggacaattattggggacaattgcatttatggcacctgaggtcctaagaggtcagcagtat
ggtaggagctgtgatgtatggagtgttggctgtgctattatagaaatggcttgtgctaaa
ccaccttggaatgcagaaaaacactccaatcatcttgctttgatatttaagattgccagt
gcaactactgctccatcaatcccttcacatttgtctcctggtttacgagatgtggctctt
cgctgtttagaacttcaacctcaggacagacctccatcaagagagctactgaagcatcca
gtcttccgtactacgtggtag

DBGET integrated database retrieval system