KEGG   Lipotes vexillifer (Yangtze River dolphin): 103075877Help
Entry
103075877         CDS       T03090                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00010  Glycolysis / Gluconeogenesis
lve00053  Ascorbate and aldarate metabolism
lve00071  Fatty acid degradation
lve00280  Valine, leucine and isoleucine degradation
lve00310  Lysine degradation
lve00330  Arginine and proline metabolism
lve00340  Histidine metabolism
lve00380  Tryptophan metabolism
lve00410  beta-Alanine metabolism
lve00561  Glycerolipid metabolism
lve00620  Pyruvate metabolism
lve01100  Metabolic pathways
Module
lve_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103075877
   00053 Ascorbate and aldarate metabolism
    103075877
   00620 Pyruvate metabolism
    103075877
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103075877
   00561 Glycerolipid metabolism
    103075877
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103075877
   00310 Lysine degradation
    103075877
   00330 Arginine and proline metabolism
    103075877
   00340 Histidine metabolism
    103075877
   00380 Tryptophan metabolism
    103075877
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103075877
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103075877
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103075877
NCBI-ProteinID: XP_007448232
UniProt: A0A340WKU4
LinkDB All DBs
Position
Un
AA seq 519 aa AA seqDB search
MLRAVVLAAARPCQGRRLLSAAATPAVPAPNQQPEVFYNKIFINNEWHDSVSKKTFPTIN
PSTGDVICHVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASKRGWLLTRLADLIERDRTY
LAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGV
CGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNII
PGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQTAAGNSNLKRVTLELGGKSPNIIMSDA
DMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYTEFVERSVARARSRVVGNPFDSRTEQ
GPQVDETQFKKVLGYIKSGKEEGAKLLCGGGAAADCGYFIQPTVFGDVQDGMTIAKEEIF
GPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKASYLSQALQAGTVWVNCYDVFGA
QSPFGGYKLSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgcagttgtgctcgccgccgcccggccctgccagggccgccggctgctgtcg
gccgccgccaccccggccgtgccggcccccaaccagcagcccgaggtcttctacaacaag
atcttcataaacaatgagtggcatgattctgtcagcaagaaaactttccccaccatcaat
ccatccactggggatgtcatctgtcatgtagctgaaggggacaaggaagacgtggacagg
gcagtgaaggctgcccgggctgcattccagctgggctcgccctggcgccgcatggatgcg
tccaaaaggggctggctgctgacccgcctggctgatctgattgagcgggaccggacctac
ctggcagccttggagaccctggacaacggcaagccctatgtcatttcctacctggtggat
ttggacatggttctcaaatgtctccgttactatgcaggctgggctgataagtaccacgga
aaaaccattcctatcgatggggattacttcagctacacccgccatgaacctgtgggagtg
tgtgggcagatcatcccgtggaacttcccgctcttgatgcaagcatggaaactgggccca
gccttggcgactggaaatgtggttgtgatgaaggtggctgagcagactccactcactgcc
ctctatgtggccaacttgattaaggaggccggctttcctcctggcgtggtcaatatcata
cctggatttggccccacggctggggctgccattgcctcccatgaggatgtggacaaagtg
gccttcacaggctccactgaggttggccacctaatccagactgctgcggggaacagtaac
ctcaagagagtgaccctggagctaggaggaaagagtcccaatatcatcatgtcagatgct
gacatggactgggctgtggagcaggcccacttcgccctgttcttcaaccagggccagtgc
tgctgtgcaggttcccggacctttgtgcaggaggacatttacaccgagtttgtggagcgg
agtgttgcccgggccaggtctcgtgtggtcgggaacccctttgacagccggactgagcag
gggccgcaggtggatgaaactcagtttaagaaggtccttggctacatcaaatctgggaag
gaggagggggcgaagctgctgtgtggtggaggggcggctgctgactgtggctacttcatc
cagcccaccgtgtttggagacgtgcaggatggcatgaccatcgccaaggaggagatcttt
gggccagtgatgcagattctgaagttcaagaccatagaggaagtcgttgggagagccaac
aattccaagtacgggctggccgcagctgtcttcacaaaggacttggacaaggccagttat
ctgtcccaagccctccaggctggcaccgtgtgggtcaactgctatgatgtgtttggggcc
cagtcaccgtttggtggctacaagctgtctgggagcggccgggagctgggagagtatggg
ctgcaggcatacactgaagtgaaaactgtcacagtcaaagttcctcagaagaactcataa

DBGET integrated database retrieval system