KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076182
Entry
103076182         CDS       T03090                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00230  Purine metabolism
lve01100  Metabolic pathways
lve01522  Endocrine resistance
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04714  Thermogenesis
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04727  GABAergic synapse
lve04740  Olfactory transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04913  Ovarian steroidogenesis
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04923  Regulation of lipolysis in adipocytes
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04962  Vasopressin-regulated water reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04976  Bile secretion
lve05032  Morphine addiction
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05200  Pathways in cancer
lve05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103076182 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103076182 (ADCY3)
   04371 Apelin signaling pathway
    103076182 (ADCY3)
   04020 Calcium signaling pathway
    103076182 (ADCY3)
   04072 Phospholipase D signaling pathway
    103076182 (ADCY3)
   04024 cAMP signaling pathway
    103076182 (ADCY3)
   04022 cGMP-PKG signaling pathway
    103076182 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103076182 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103076182 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103076182 (ADCY3)
   04062 Chemokine signaling pathway
    103076182 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    103076182 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    103076182 (ADCY3)
   04912 GnRH signaling pathway
    103076182 (ADCY3)
   04913 Ovarian steroidogenesis
    103076182 (ADCY3)
   04915 Estrogen signaling pathway
    103076182 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    103076182 (ADCY3)
   04921 Oxytocin signaling pathway
    103076182 (ADCY3)
   04926 Relaxin signaling pathway
    103076182 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    103076182 (ADCY3)
   04918 Thyroid hormone synthesis
    103076182 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    103076182 (ADCY3)
   04916 Melanogenesis
    103076182 (ADCY3)
   04925 Aldosterone synthesis and secretion
    103076182 (ADCY3)
   04927 Cortisol synthesis and secretion
    103076182 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103076182 (ADCY3)
   04270 Vascular smooth muscle contraction
    103076182 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    103076182 (ADCY3)
   04971 Gastric acid secretion
    103076182 (ADCY3)
   04972 Pancreatic secretion
    103076182 (ADCY3)
   04976 Bile secretion
    103076182 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103076182 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103076182 (ADCY3)
   04727 GABAergic synapse
    103076182 (ADCY3)
   04725 Cholinergic synapse
    103076182 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    103076182 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    103076182 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    103076182 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    103076182 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    103076182 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103076182 (ADCY3)
   04714 Thermogenesis
    103076182 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103076182 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    103076182 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103076182 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103076182 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103076182 (ADCY3)
   05163 Human cytomegalovirus infection
    103076182 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103076182 (ADCY3)
Enzymes [BR:lve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     103076182 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 103076182
NCBI-ProteinID: XP_007455568
UniProt: A0A340X1W5
LinkDB
Position
Un
AA seq 1141 aa
MPRTQGFSDPEYSAEYSAEYSVSLPSDPDRRVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGVGLVLDII
LFVLCRKGLLPTRVTRKVVPYLLWLLITAQVFCLGLNFSRAHAASDTVGWQAFFVFSFFI
TLPLSLSPIVVISVVSCIVHTLVLGVTVAQQQRDGLKGMQLLREILANVFLYLCAIVVGI
MSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDESQ
KDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQL
RIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTVL
GGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCDY
LDEKGIETYLIIATKPEVKRTAAQNGLSGSALLNGVPPSSKPGSPALIETKEPNGSIHTS
GSTSEEPDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQVVR
KRNTFFLSMRFTDREMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTNYVTF
VVGEVLLLTLTVCSLAAIFPRAFPKKIVAFSTWIDRTRWARNTWAMLAIFILVMANVVDM
LSCLQYYMGPTNGTSGVQIEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLMLLIA
GAVAVINIYAWRPIFDEYDRRRFQEHDFPMVALEKMQVPSSPGLNGTDRLPLVPSRCSMT
GMIFVMTLGFYYFCRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARH
FLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLL
DNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKVERSDKERWQHLADLADFALAM
KDTLANINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNI
QVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGREKPATFPNGSSVTLPHQVVDN
S
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgatcctgagtactcggccgaatactcggccgagtac
tccgtcagcctgccctctgaccctgaccgcagggtgggccggacccatgagatctctgtc
cgcaactcgggatcctgcctgtgcctgcctcgcttcatgcggctgaccttcgtgccggag
tccttggagaacctgtaccagacctacttcaaaaggcagcgccacgagacgctgctggtg
ctggtggtattcgcggccctcttcgactgctacgtggtggtcatgtgcgcggtggtcttc
tccagtgacaagctggctcccctggctgtggccggggtcgggctggtgttggacatcatc
ctctttgtgctctgcagaaaggggctgctgcccacccgggtcacccggaaagtggtgccc
tacctgctgtggctgctgataacagcccaggtcttctgcctgggcctgaacttctcccgc
gcgcacgcagccagcgacacggtgggctggcaggccttctttgtcttctccttcttcatc
acgctgcccctcagcctcagccccatcgtcgtcatctctgtggtctcctgcatcgtgcac
acgcttgtcttgggggtcaccgtggcccagcagcagcgggacgggctgaaggggatgcag
ttgctgagggagattctggccaatgtcttcctctatctgtgcgccatcgttgtgggcatc
atgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccagtcg
ctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctttcc
atcctgcccaagcacgtggcagacgagatgctgaaggacatgaaaaaggacgagagccag
aaggaccagcagcagttcaacaccatgtacatgtaccgccacgagaatgtcagcatcctg
tttgccgacatcgtgggcttcacccagctgtcctcagcctgcagcgcccaagagctcgtg
aagctcctcaatgagctctttgcccgcttcgacaagctggcggccaaataccaccagctg
cggattaagattctgggcgactgttactactgcatctgtgggctgcctgactaccgcgag
gaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtatgta
cgggagaagacgaagaccggggtggacatgcgagtcggggtgcacacgggcaccgtgctg
gggggtgtcctgggccagaagcgctggcagtacgacgtgtggtccaccgatgtcaccgtg
gccaacaagatggaggccggcggcatccccgggcgtgtgcacatctcccagagcaccatg
gactgcctgaaaggcgagtttgacgtggagccaggtgatgggggcagccgctgtgattac
ctggatgagaagggcatcgaaacctacctcatcattgcgaccaagccagaggtgaagagg
acagctgcccaaaatggcctcagcggctcagctctgctgaacggagtgccaccttcctca
aagcccggctcccctgccctcattgagaccaaggagcctaacgggagcatccacaccagc
ggctccacgtccgaggagccagatgcccaggctgacaacccctcattccccaaccctcgc
cggaggctgcggcttcaggacctggccgatcgcgtggtggacgcctccgaggatgagcac
gagctcaaccagctgctcaacgaggccctgctggagcgggagtccgcccaggtggtgagg
aagagaaacaccttcttcctgtccatgcggttcacggaccgcgagatggaaacgcgctac
tcggtggagaaggagaagcagagcggggccgccttcagctgttcctgcgtcgtcctgctc
tgcaccgccctggttgagattctcatcgacccctggctgatgacaaactatgtgaccttt
gtggttggcgaggtcctgctcctgaccctgactgtctgctcgctggctgccatctttcct
cgggcctttcctaagaagatcgtggccttctcgacttggatcgaccggacgcgctgggcc
aggaacacctgggccatgctggccatcttcattctggtcatggcaaacgtcgtggacatg
cttagctgtctccagtactacatgggacccaccaacggcacctcaggggtgcagatagag
gacggctgcgtggagaaccccaagtattacaactacgtcgctgtgctgtccctcatcgcc
accatcatgctggtgcaggtcagccacatggtcaagctgacactcatgctgctcatcgca
ggggctgtggccgtcatcaacatctacgcctggcgccccatctttgatgaatacgaccgc
agacgcttccaagaacacgactttccgatggtggccttagagaagatgcaggtaccttcc
agccctgggctcaatggcactgacaggctgcccctggtgccgtccaggtgctcgatgaca
gggatgatcttcgtcatgacgctcggcttctactacttctgccgccacgtggagaagctg
gcacgaacactgttcttatggaagattgaggtccacgaccagaaggaacgtgtctatgaa
atgagacgctggaacgaggccttggtcactaacatgttgcctgagcacgtggcacgccat
ttcctggggtccaagaagagagacgaggagctgtacagtcagtcttatgacgagattgga
gtcatgtttgcctccctgcccaactttgccgacttctacacagaggagagcatcaataac
ggtggcattgagtgtctgcgcttcctcaatgagatcatctcagattttgactctctcctg
gacaatcccaagtttcgggtcatcaccaagatcaaaaccattggcagcacctacatggca
gcttcaggagtcaccccagatgtcaacaccaatggctttaccagctccaacaaggtagag
aggtcggacaaggagcgctggcagcacctggcagatctggccgacttcgcgctcgccatg
aaagacacgctcgccaacatcaacaaccagtccttcaataacttcatgttgcgcatcggc
atgaacaaaggaggggtactggctggcgtcatcggagcccggaaaccacactatgacatc
tggggcaatacagtcaacgttgccagcaggatggagtccacaggggtcatgggcaacatt
caggtggtggaagaaactcaagtcatccttcgagagtacggcttccgctttgtgaggaga
gggcccatctttgtgaaagggaagggggagctgctgacctttttcttgaaggggcgagag
aagccagccacgttccctaatggctcctcggttacactgccccaccaggtagtagacaac
tcctga

DBGET integrated database retrieval system