KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076924
Entry
103076924         CDS       T03090                                 

Gene name
GNA11
Definition
(RefSeq) G protein subunit alpha 11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04270  Vascular smooth muscle contraction
lve04540  Gap junction
lve04725  Cholinergic synapse
lve04730  Long-term depression
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05142  Chagas disease
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103076924 (GNA11)
   04022 cGMP-PKG signaling pathway
    103076924 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103076924 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103076924 (GNA11)
   04929 GnRH secretion
    103076924 (GNA11)
   04912 GnRH signaling pathway
    103076924 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    103076924 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    103076924 (GNA11)
   04925 Aldosterone synthesis and secretion
    103076924 (GNA11)
   04927 Cortisol synthesis and secretion
    103076924 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103076924 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    103076924 (GNA11)
   04730 Long-term depression
    103076924 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103076924 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103076924 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103076924 (GNA11)
   05163 Human cytomegalovirus infection
    103076924 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103076924 (GNA11)
   05142 Chagas disease
    103076924 (GNA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103076924 (GNA11)
   04031 GTP-binding proteins [BR:lve04031]
    103076924 (GNA11)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103076924 (GNA11)
  Exosomal proteins of melanoma cells
   103076924 (GNA11)
GTP-binding proteins [BR:lve04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103076924 (GNA11)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 103076924
NCBI-ProteinID: XP_007460388
UniProt: A0A340XG36
LinkDB
Position
Un
AA seq 359 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKCEQNKANALLIREVDVEK
VTTFEHRYVSAIKTLWNDPGIQECYDRRREYQLSDSAKYYLTDVDRIATSGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIVTYPWFQNSSVILFLNKKDLLEDKILHSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgaaatcgagaaacagctgcggcgggacaagcgcgacgctcggcgcgagctc
aagctactgctgctcggcacgggcgagagcgggaagagcactttcatcaagcagatgcgc
atcatccacggggcgggctactcggaggaggacaagcggggcttcaccaagctggtgtac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagaccctgaagatcctc
tacaagtgcgagcagaacaaggccaacgcgctcctgatccgggaggtggacgtggagaag
gtcaccaccttcgagcaccggtacgtgagtgccatcaagaccctgtggaacgaccccggc
atccaggagtgctacgaccgccggcgggagtaccagctctcggactccgccaagtactac
ctgactgacgtggaccgcatcgccacctcgggctacctgcccacccagcaggacgtgctg
cgagtgcgcgtgcccaccactggcatcatcgagtaccccttcgacctggagaacatcatc
ttcaggatggtggacgtggggggccagaggtccgagcggaggaagtggatccactgcttt
gagaacgtgacgtccatcatgttcctcgtggccctcagcgagtacgaccaggtgctggtg
gagtcggacaacgagaaccgcatggaggagagcaaggcgctgttccggaccatcgtcacc
tacccctggttccagaactcgtccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctccactcgcacctggtggattacttccccgagttcgacggcccgcagcgg
gacgcgcaggccgcccgggagttcatcctgaagatgtttgtggacctgaaccccgacagc
gacaagatcatctattcccacttcacgtgcgccaccgacacggagaacatccgcttcgtc
ttcgccgctgtcaaggacaccatcctgcagctcaacctgaaggagtacaacctggtgtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082420
Entry
103082420         CDS       T03090                                 

Gene name
GNAQ
Definition
(RefSeq) G protein subunit alpha q
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04062  Chemokine signaling pathway
lve04071  Sphingolipid signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05135  Yersinia infection
lve05142  Chagas disease
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103082420 (GNAQ)
   04371 Apelin signaling pathway
    103082420 (GNAQ)
   04020 Calcium signaling pathway
    103082420 (GNAQ)
   04071 Sphingolipid signaling pathway
    103082420 (GNAQ)
   04022 cGMP-PKG signaling pathway
    103082420 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103082420 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103082420 (GNAQ)
   04062 Chemokine signaling pathway
    103082420 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    103082420 (GNAQ)
   04922 Glucagon signaling pathway
    103082420 (GNAQ)
   04929 GnRH secretion
    103082420 (GNAQ)
   04912 GnRH signaling pathway
    103082420 (GNAQ)
   04915 Estrogen signaling pathway
    103082420 (GNAQ)
   04921 Oxytocin signaling pathway
    103082420 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    103082420 (GNAQ)
   04918 Thyroid hormone synthesis
    103082420 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    103082420 (GNAQ)
   04916 Melanogenesis
    103082420 (GNAQ)
   04924 Renin secretion
    103082420 (GNAQ)
   04925 Aldosterone synthesis and secretion
    103082420 (GNAQ)
   04927 Cortisol synthesis and secretion
    103082420 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103082420 (GNAQ)
   04270 Vascular smooth muscle contraction
    103082420 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    103082420 (GNAQ)
   04971 Gastric acid secretion
    103082420 (GNAQ)
   04972 Pancreatic secretion
    103082420 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103082420 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    103082420 (GNAQ)
   04725 Cholinergic synapse
    103082420 (GNAQ)
   04728 Dopaminergic synapse
    103082420 (GNAQ)
   04726 Serotonergic synapse
    103082420 (GNAQ)
   04720 Long-term potentiation
    103082420 (GNAQ)
   04730 Long-term depression
    103082420 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    103082420 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103082420 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103082420 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103082420 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103082420 (GNAQ)
   05016 Huntington disease
    103082420 (GNAQ)
   05017 Spinocerebellar ataxia
    103082420 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    103082420 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103082420 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103082420 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103082420 (GNAQ)
   05163 Human cytomegalovirus infection
    103082420 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103082420 (GNAQ)
   05142 Chagas disease
    103082420 (GNAQ)
   05143 African trypanosomiasis
    103082420 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103082420 (GNAQ)
   04031 GTP-binding proteins [BR:lve04031]
    103082420 (GNAQ)
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103082420 (GNAQ)
GTP-binding proteins [BR:lve04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    103082420 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 103082420
NCBI-ProteinID: XP_007459948
UniProt: A0A340XET8
LinkDB
Position
Un
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggctaaggaagcccggcgg
atcaacgacgagattgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcgggctactctgatgaagacaaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaataaggctcacgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccgtatgtagatgcaataaagagtttatggaacgatcctgga
atccaggaatgctatgacagacgacgggaatatcagttatctgactctaccaaatactat
cttaatgacttggaccgcgttgccgaccctgcctacctgcctacgcaacaagatgtgctc
agagttcgagtccccaccacagggatcatcgagtacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatacgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcacg
tatccctggttccagaactcctcagttattctgttcttaaacaagaaagaccttctagag
gagaaaattatgtattcccacctagttgattacttcccagaatatgatggaccccagcga
gatgcccaggcagctcgagaattcatcctgaagatgttcgtggacctgaatccagacagt
gacaaaatcatctactcccatttcacatgcgccacagacaccgagaacatccgctttgtc
tttgccgccgtcaaagacaccatcctccaattgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system