KEGG   Lipotes vexillifer (Yangtze River dolphin): 103076982
Entry
103076982         CDS       T03090                                 

Gene name
TGFA
Definition
(RefSeq) transforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04915  Estrogen signaling pathway
lve05200  Pathways in cancer
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05212  Pancreatic cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05223  Non-small cell lung cancer
lve05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103076982 (TGFA)
   04012 ErbB signaling pathway
    103076982 (TGFA)
   04014 Ras signaling pathway
    103076982 (TGFA)
   04151 PI3K-Akt signaling pathway
    103076982 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    103076982 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103076982 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103076982 (TGFA)
   05212 Pancreatic cancer
    103076982 (TGFA)
   05225 Hepatocellular carcinoma
    103076982 (TGFA)
   05214 Glioma
    103076982 (TGFA)
   05211 Renal cell carcinoma
    103076982 (TGFA)
   05215 Prostate cancer
    103076982 (TGFA)
   05223 Non-small cell lung cancer
    103076982 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103076982 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 103076982
NCBI-ProteinID: XP_007453492
UniProt: A0A340X0Q8
LinkDB
Position
Un
AA seq 145 aa
MSCYALDLSRMSFLSPADPPVAAAVVSHFNDCPASHSQFCFHGTCRFLVQEDKPACVCHS
GYVGARCEHADLLAVVAASQKKQAITALVVVSIVALTVLIITCVLIHCCQVRKHCEWCRA
LICWHEKPSALLKGRTACCHSETVV
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcttgctatgccttggatctgagccgaatgtcttttctctccccagcagacccgcct
gtggccgcagctgtggtgtcccattttaatgactgccctgcttcccacagtcagttctgc
ttccatggaacctgccggtttttggtgcaggaggacaagccagcatgtgtctgccactct
gggtacgtcggcgcacgctgtgaacacgcggacctcctggccgtggtggccgccagccag
aagaagcaggccattactgccttggtggtggtctccatcgtggccctgactgtcctcatc
atcacgtgtgtgctgatacactgctgccaggtccgaaaacactgtgaatggtgccgggcc
ctcatctgctggcacgagaagcccagtgccctcctgaagggaaggactgcttgctgccac
tcagaaacagtggtctga

DBGET integrated database retrieval system