KEGG   Lipotes vexillifer (Yangtze River dolphin): 103077530
Entry
103077530         CDS       T03090                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04114  Oocyte meiosis
lve04218  Cellular senescence
lve04261  Adrenergic signaling in cardiomyocytes
lve04370  VEGF signaling pathway
lve04380  Osteoclast differentiation
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04670  Leukocyte transendothelial migration
lve04714  Thermogenesis
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05205  Proteoglycans in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103077530 (MAPK12)
   04015 Rap1 signaling pathway
    103077530 (MAPK12)
   04370 VEGF signaling pathway
    103077530 (MAPK12)
   04668 TNF signaling pathway
    103077530 (MAPK12)
   04068 FoxO signaling pathway
    103077530 (MAPK12)
   04071 Sphingolipid signaling pathway
    103077530 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103077530 (MAPK12)
   04218 Cellular senescence
    103077530 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103077530 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103077530 (MAPK12)
   04613  Neutrophil extracellular trap formation
    103077530 (MAPK12)
   04620 Toll-like receptor signaling pathway
    103077530 (MAPK12)
   04621 NOD-like receptor signaling pathway
    103077530 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    103077530 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    103077530 (MAPK12)
   04660 T cell receptor signaling pathway
    103077530 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    103077530 (MAPK12)
   04659 Th17 cell differentiation
    103077530 (MAPK12)
   04657 IL-17 signaling pathway
    103077530 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    103077530 (MAPK12)
   04670 Leukocyte transendothelial migration
    103077530 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103077530 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    103077530 (MAPK12)
   04917 Prolactin signaling pathway
    103077530 (MAPK12)
   04926 Relaxin signaling pathway
    103077530 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    103077530 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103077530 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    103077530 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    103077530 (MAPK12)
   04722 Neurotrophin signaling pathway
    103077530 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103077530 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103077530 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    103077530 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103077530 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103077530 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103077530 (MAPK12)
   05020 Prion disease
    103077530 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    103077530 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103077530 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103077530 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103077530 (MAPK12)
   05135 Yersinia infection
    103077530 (MAPK12)
   05133 Pertussis
    103077530 (MAPK12)
   05152 Tuberculosis
    103077530 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103077530 (MAPK12)
   05161 Hepatitis B
    103077530 (MAPK12)
   05171 Coronavirus disease - COVID-19
    103077530 (MAPK12)
   05163 Human cytomegalovirus infection
    103077530 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103077530 (MAPK12)
   05169 Epstein-Barr virus infection
    103077530 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103077530 (MAPK12)
   05140 Leishmaniasis
    103077530 (MAPK12)
   05142 Chagas disease
    103077530 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103077530 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103077530 (MAPK12)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103077530 (MAPK12)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103077530 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 103077530
NCBI-ProteinID: XP_007453950
UniProt: A0A340X472
LinkDB
Position
Un
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPAGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPNETLDDFTDFYLVMPFMGTDLGKLM
KHEKLSEDRIQFLVYQMLKGLKYIHAAGIIHRDLKPSNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGXXXFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSAEAQNYMNGLPELEKKDFAAILTNASPLAVALLEKMLVLDAERRV
TAAKALTHPYFESLHDTEDEPKAQKYDESFDDLDRTLEEWKRVTYREVLSFKPPRQLGAK
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcaagggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgcaggctcgggcgcctacggcgcc
gtgtgctcggcggtggacagccgcacgggcgccaaggtggccataaagaagctgtaccgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccatgagaacgtaattgggctgctggatgtgttcacacccaatgagaccctggat
gatttcacagacttttacctggtgatgccgttcatgggcaccgacctggggaagctcatg
aagcatgagaagctgagtgaggaccgaatccagttcctcgtctaccagatgctcaagggg
ctgaagtacatccatgctgctggcatcatccacagggacctgaagcccagcaacctggcc
gtgaatgaggactgtgagctcaagatcctggactttggcctggcccggcaggcagatagc
gagatgactggatacgtggtgacccggtggtaccgggcgcctgaggtcatcttgaattgg
atgcactacacacagacggtggacatctggtcagtgggctgcatcatggctgagatgatc
acaggnnnnnnnnncttcaaaggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctcccgccgagttcgtgcagaggctgcagagtgctgaggctcagaac
tacatgaacggcctccccgagctagagaaaaaggattttgccgccatcctgaccaacgcg
agccctctggccgtggccctcctggagaagatgctggtgctggatgcggagcggcgggtg
acggcggccaaggcgctgacccacccctacttcgagtcgctgcacgacacggaggacgag
cccaaagcccaaaagtatgatgaatcctttgatgacctggaccgcacgctggaagagtgg
aagcgtgtcacatatagagaggtgctcagcttcaagcctccccgacagctgggggccaag
gtctccaaggagacggccctgtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078049
Entry
103078049         CDS       T03090                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04114  Oocyte meiosis
lve04218  Cellular senescence
lve04261  Adrenergic signaling in cardiomyocytes
lve04370  VEGF signaling pathway
lve04380  Osteoclast differentiation
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04670  Leukocyte transendothelial migration
lve04714  Thermogenesis
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05205  Proteoglycans in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103078049 (MAPK14)
   04015 Rap1 signaling pathway
    103078049 (MAPK14)
   04370 VEGF signaling pathway
    103078049 (MAPK14)
   04668 TNF signaling pathway
    103078049 (MAPK14)
   04068 FoxO signaling pathway
    103078049 (MAPK14)
   04071 Sphingolipid signaling pathway
    103078049 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103078049 (MAPK14)
   04218 Cellular senescence
    103078049 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103078049 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103078049 (MAPK14)
   04613  Neutrophil extracellular trap formation
    103078049 (MAPK14)
   04620 Toll-like receptor signaling pathway
    103078049 (MAPK14)
   04621 NOD-like receptor signaling pathway
    103078049 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    103078049 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    103078049 (MAPK14)
   04660 T cell receptor signaling pathway
    103078049 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    103078049 (MAPK14)
   04659 Th17 cell differentiation
    103078049 (MAPK14)
   04657 IL-17 signaling pathway
    103078049 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    103078049 (MAPK14)
   04670 Leukocyte transendothelial migration
    103078049 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103078049 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    103078049 (MAPK14)
   04917 Prolactin signaling pathway
    103078049 (MAPK14)
   04926 Relaxin signaling pathway
    103078049 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    103078049 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103078049 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    103078049 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    103078049 (MAPK14)
   04722 Neurotrophin signaling pathway
    103078049 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103078049 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103078049 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    103078049 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103078049 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103078049 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103078049 (MAPK14)
   05020 Prion disease
    103078049 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    103078049 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103078049 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103078049 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103078049 (MAPK14)
   05135 Yersinia infection
    103078049 (MAPK14)
   05133 Pertussis
    103078049 (MAPK14)
   05152 Tuberculosis
    103078049 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103078049 (MAPK14)
   05161 Hepatitis B
    103078049 (MAPK14)
   05171 Coronavirus disease - COVID-19
    103078049 (MAPK14)
   05163 Human cytomegalovirus infection
    103078049 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103078049 (MAPK14)
   05169 Epstein-Barr virus infection
    103078049 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103078049 (MAPK14)
   05140 Leishmaniasis
    103078049 (MAPK14)
   05142 Chagas disease
    103078049 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103078049 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103078049 (MAPK14)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103078049 (MAPK14)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103078049 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 103078049
NCBI-ProteinID: XP_007467325
UniProt: A0A340Y744
LinkDB
Position
Un
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccaaaacctgtccccggtgggctccggcgcctatggctccgtgtgtgct
gcttttgacacaaaaactgggttacgtgttgcagtgaagaagctatccagaccatttcag
tccattattcatgccaaaaggacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgttttcacacctgcaaggtctctggaggaattcaat
gatgtgtacctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccacgttcagttccttatctaccagattctccgagggctcaagtat
atacattcagccgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagatcttggattttggactggctcgacatacagatgatgaaatgaca
ggctatgtagccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactacattcag
tctttgacccagatgccaaagatgaactttgcaaatgtatttattggtgccaatcccttg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcagcg
caagcccttgcacatgcctactttgcccagtaccatgatcctgacgatgaaccagtggct
gatccttacgatcagtctttcgaaagcagggacctccttatagatgaatggaaaagcctg
acctacgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtct
tga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078710
Entry
103078710         CDS       T03090                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04114  Oocyte meiosis
lve04218  Cellular senescence
lve04261  Adrenergic signaling in cardiomyocytes
lve04370  VEGF signaling pathway
lve04380  Osteoclast differentiation
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04670  Leukocyte transendothelial migration
lve04714  Thermogenesis
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05205  Proteoglycans in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103078710 (MAPK13)
   04015 Rap1 signaling pathway
    103078710 (MAPK13)
   04370 VEGF signaling pathway
    103078710 (MAPK13)
   04668 TNF signaling pathway
    103078710 (MAPK13)
   04068 FoxO signaling pathway
    103078710 (MAPK13)
   04071 Sphingolipid signaling pathway
    103078710 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103078710 (MAPK13)
   04218 Cellular senescence
    103078710 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103078710 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103078710 (MAPK13)
   04613  Neutrophil extracellular trap formation
    103078710 (MAPK13)
   04620 Toll-like receptor signaling pathway
    103078710 (MAPK13)
   04621 NOD-like receptor signaling pathway
    103078710 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    103078710 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    103078710 (MAPK13)
   04660 T cell receptor signaling pathway
    103078710 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    103078710 (MAPK13)
   04659 Th17 cell differentiation
    103078710 (MAPK13)
   04657 IL-17 signaling pathway
    103078710 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    103078710 (MAPK13)
   04670 Leukocyte transendothelial migration
    103078710 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103078710 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    103078710 (MAPK13)
   04917 Prolactin signaling pathway
    103078710 (MAPK13)
   04926 Relaxin signaling pathway
    103078710 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    103078710 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103078710 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    103078710 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    103078710 (MAPK13)
   04722 Neurotrophin signaling pathway
    103078710 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103078710 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103078710 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    103078710 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103078710 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103078710 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103078710 (MAPK13)
   05020 Prion disease
    103078710 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    103078710 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103078710 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103078710 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103078710 (MAPK13)
   05135 Yersinia infection
    103078710 (MAPK13)
   05133 Pertussis
    103078710 (MAPK13)
   05152 Tuberculosis
    103078710 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103078710 (MAPK13)
   05161 Hepatitis B
    103078710 (MAPK13)
   05171 Coronavirus disease - COVID-19
    103078710 (MAPK13)
   05163 Human cytomegalovirus infection
    103078710 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103078710 (MAPK13)
   05169 Epstein-Barr virus infection
    103078710 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103078710 (MAPK13)
   05140 Leishmaniasis
    103078710 (MAPK13)
   05142 Chagas disease
    103078710 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103078710 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103078710 (MAPK13)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103078710 (MAPK13)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103078710 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 APH Kinase-like Kdo DUF4023
Other DBs
NCBI-GeneID: 103078710
NCBI-ProteinID: XP_007467328
UniProt: A0A340Y1Z1
LinkDB
Position
Un
AA seq 366 aa
MNFTWKKGFYKQDVNKTAWELPKIYVSLTHVGSGAYGAVCSAIDKQSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSPRNFHDFYLVMPFMQTDLQKIMGM
EFGEDKIQYLVYQMLKGLKYIHSAGVIHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPDAEFVQKLNDKAAKSYIQSLPQSPKQDFSQLFPHASPQAADLLEKMLELDLDKRLTAS
QALTHPFFESCRDPEEETEAQQPFDDFLEHEKLTADEWKQHIYKEIVNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgaacttcacctggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagatctacgtgtccctgacgcacgtaggcagtggggcctacggcgccgtgtgc
tcagccatcgacaagcagtcgggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgggcctatcgcgagctgctgctgctgaagcacatgcag
catgagaacgtcatcggactcctggatgtcttcaccccagcctcttccccgcgcaacttt
catgatttctacctggtgatgcccttcatgcagacggacttgcagaagatcatgggaatg
gagttcggtgaggacaagatccagtacctggtgtatcagatgctcaaaggtcttaagtac
atccactcagctggggtcatccacagggacctgaagccaggcaaccttgctgtcaatgag
gattgtgagctgaagattttggattttgggttggcacggcatgcagatgcagagatgact
ggctatgtggtgacccgctggtaccgggcccctgaggtgatcctcagctggatgcactac
aaccagactgtggacatctggtctgtgggctgtatcatggcagagatgctgacggggaaa
actctcttcaaggggaaagattacctggaccagctgacgcagatcctgaaagtgacgggg
gtgccggacgctgagtttgtgcagaagttgaatgacaaagcggccaaatcctacatccag
tccctgccacaaagccccaagcaggatttctctcagctcttcccgcatgccagcccccag
gctgcagacctgctagagaagatgctggagctggacttggacaagcgcctgaccgcctct
caggccctcacccaccccttctttgaatcctgccgggaccctgaggaggaaacagaggcc
cagcagccatttgatgatttcttagaacatgagaaactcacagcggatgaatggaagcag
cacatttacaaggagattgtgaacttcagccccatcgctcggaaggactctcggcgccgg
agtggcatgaagctgcagtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083209
Entry
103083209         CDS       T03090                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04114  Oocyte meiosis
lve04218  Cellular senescence
lve04261  Adrenergic signaling in cardiomyocytes
lve04370  VEGF signaling pathway
lve04380  Osteoclast differentiation
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04670  Leukocyte transendothelial migration
lve04714  Thermogenesis
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04926  Relaxin signaling pathway
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05140  Leishmaniasis
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05205  Proteoglycans in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103083209 (MAPK11)
   04015 Rap1 signaling pathway
    103083209 (MAPK11)
   04370 VEGF signaling pathway
    103083209 (MAPK11)
   04668 TNF signaling pathway
    103083209 (MAPK11)
   04068 FoxO signaling pathway
    103083209 (MAPK11)
   04071 Sphingolipid signaling pathway
    103083209 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    103083209 (MAPK11)
   04218 Cellular senescence
    103083209 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103083209 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103083209 (MAPK11)
   04613  Neutrophil extracellular trap formation
    103083209 (MAPK11)
   04620 Toll-like receptor signaling pathway
    103083209 (MAPK11)
   04621 NOD-like receptor signaling pathway
    103083209 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    103083209 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    103083209 (MAPK11)
   04660 T cell receptor signaling pathway
    103083209 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    103083209 (MAPK11)
   04659 Th17 cell differentiation
    103083209 (MAPK11)
   04657 IL-17 signaling pathway
    103083209 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    103083209 (MAPK11)
   04670 Leukocyte transendothelial migration
    103083209 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083209 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    103083209 (MAPK11)
   04917 Prolactin signaling pathway
    103083209 (MAPK11)
   04926 Relaxin signaling pathway
    103083209 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    103083209 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103083209 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    103083209 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    103083209 (MAPK11)
   04722 Neurotrophin signaling pathway
    103083209 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103083209 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103083209 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    103083209 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103083209 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103083209 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103083209 (MAPK11)
   05020 Prion disease
    103083209 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    103083209 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103083209 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103083209 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103083209 (MAPK11)
   05135 Yersinia infection
    103083209 (MAPK11)
   05133 Pertussis
    103083209 (MAPK11)
   05152 Tuberculosis
    103083209 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103083209 (MAPK11)
   05161 Hepatitis B
    103083209 (MAPK11)
   05171 Coronavirus disease - COVID-19
    103083209 (MAPK11)
   05163 Human cytomegalovirus infection
    103083209 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103083209 (MAPK11)
   05169 Epstein-Barr virus infection
    103083209 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103083209 (MAPK11)
   05140 Leishmaniasis
    103083209 (MAPK11)
   05142 Chagas disease
    103083209 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103083209 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103083209 (MAPK11)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103083209 (MAPK11)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103083209 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 103083209
NCBI-ProteinID: XP_007454143
UniProt: A0A340WXR5
LinkDB
Position
Un
AA seq 350 aa
MSEHALGVPPVKGQAALGSGRPPCSSAYDTRLRQRVAVKKLSRPFQSLIHARRTYRELRL
LKHLKHENVIGLLDVFTPATSLEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQL
LRGLKYIHSAGIIHRDLKPSNLAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIM
LNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVGTPSPEVLAKISSEH
ARTYIQSLPHMPQKDLRSIFHGANPLAVDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDP
EDEPEAEPYDESVEAKERTVEEWKELTYQEVLSFKPPEPPQPPGSLDVKQ
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtctgagcatgcattgggggtgcccccggtcaagggccaggcagccctgggctctggc
aggccgccttgcagctcagcctacgacacgcggctgcgccagagggtggcggtgaagaaa
ctgtcgcgccccttccagtcgctcatccacgcgcggaggacgtaccgcgagctgcggctg
ctcaagcacctgaagcacgagaacgtcatcgggctgctggacgtgttcacgccggccacc
tccctcgaggacttcagcgaagtgtacctggtgaccacgctgatgggcgccgacctgaac
aacatcgtcaagtgccaggcgctgagcgacgagcacgttcagttcctcgtgtaccagctg
ctgcgcgggctgaagtacatccactcggcggggatcatccaccgggacctgaagcccagc
aacttggctgtgaacgaggactgcgagctgcggatcctggactttgggcttgcgcgccag
gcggacgaggagatgactggctacgtggccacgcgctggtaccgggcccctgagatcatg
ctgaactggatgcactacaaccagacagtggacatctggtctgtgggctgcatcatggcc
gagctgctccagggaaaggcccttttcccaggaaatgactacatcgaccagctgaagcgc
atcatggaggtggtgggcacacccagccctgaagttctggcaaagatatcgtcagaacat
gcccggacctacatccagtccctgccccacatgccccagaaggacctcaggagcatcttc
catggagccaaccccctggctgtggacctcctgggaaggatgctggtgctggacagtgac
cagagggtcagtgcagccgaggccctggcccatgcctacttcagccagtaccacgacccc
gaggatgagcccgaggccgagccctacgacgaaagcgttgaggccaaggagcgcacagtg
gaggagtggaaggagctcacctaccaggaagtcctcagcttcaagcccccagagccaccg
cagccgcctggcagcctggacgttaagcagtga

DBGET integrated database retrieval system