KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078301Help
Entry
103078301         CDS       T03090                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta 1
  KO
K02105  catenin beta 1
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04015  Rap1 signaling pathway
lve04310  Wnt signaling pathway
lve04390  Hippo signaling pathway
lve04510  Focal adhesion
lve04520  Adherens junction
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04670  Leukocyte transendothelial migration
lve04916  Melanogenesis
lve04919  Thyroid hormone signaling pathway
lve04934  Cushing syndrome
lve05100  Bacterial invasion of epithelial cells
lve05160  Hepatitis C
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05210  Colorectal cancer
lve05213  Endometrial cancer
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05217  Basal cell carcinoma
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103078301 (CTNNB1)
   04310 Wnt signaling pathway
    103078301 (CTNNB1)
   04390 Hippo signaling pathway
    103078301 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103078301 (CTNNB1)
   04520 Adherens junction
    103078301 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103078301 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103078301 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    103078301 (CTNNB1)
   04916 Melanogenesis
    103078301 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103078301 (CTNNB1)
   05205 Proteoglycans in cancer
    103078301 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103078301 (CTNNB1)
   05225 Hepatocellular carcinoma
    103078301 (CTNNB1)
   05226 Gastric cancer
    103078301 (CTNNB1)
   05216 Thyroid cancer
    103078301 (CTNNB1)
   05217 Basal cell carcinoma
    103078301 (CTNNB1)
   05215 Prostate cancer
    103078301 (CTNNB1)
   05213 Endometrial cancer
    103078301 (CTNNB1)
   05224 Breast cancer
    103078301 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103078301 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    103078301 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103078301 (CTNNB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103078301 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103078301 (CTNNB1)
   05163 Human cytomegalovirus infection
    103078301 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103078301 (CTNNB1)
   05165 Human papillomavirus infection
    103078301 (CTNNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Motif
Other DBs
NCBI-GeneID: 103078301
NCBI-ProteinID: XP_007464529
UniProt: A0A340XZA8
LinkDB All DBs
Position
Un
AA seq 781 aa AA seqDB search
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAMFPSGGLVAV
VPMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNEAADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctacccaagctgacttgatggagctggacatggccatggagccagacagaaaagcg
gctgttagtcactggcagcaacaatcttacctggactctggaatccattctggtgccact
accacagccccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggagcagggattttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttccct
gagacattagatgagggcatgcagatcccatcgacgcagtttgatgctgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgcta
aatgatgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacggctcgctgtactgctgggaccttgcacaat
ctttcccatcatcgtgagggcttgctggccatgtttccgtctgggggccttgttgccgtg
gtgccgatgcttggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttactgcatcaggaaggagctaaaatggcagtgcgtctagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaagttcttggctattacaacagactgc
cttcagattttagcttatggcaatcaagaaagcaagctgatcattttggctagtggtgga
cctcaagctttagtgaatataatgaggacctacacctatgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataagccagctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcagcgtcttgttcagaat
tgtctttggactctgaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgcgca
gctggaattctttctaatctcacttgcaataattacaagaacaagatgatggtgtgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggatatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagctgagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggttaaactcctacatcca
ccatcccattggcctctgatcaaggctaccgttggattgattcgaaatcttgccctttgt
cccgcaaatcacgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgccgtacatctatgggtggaacacagcagcagttt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggcctaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggagtcctctgtgaa
cttgctcaggacaaggaggctgcagaagctattgaagccgagggagccacagctcccctg
acagagttacttcattctaggaatgaaggtgtggcgacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattataagaaacggctctcggtcgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgaggctgctgatcttggacttgatatc
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatacggccaggatgccttgggtatggaccccatgatggagcatgagatgggc
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system