KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078639
Entry
103078639         CDS       T03090                                 

Gene name
PLCB4
Definition
(RefSeq) phospholipase C beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00562  Inositol phosphate metabolism
lve01100  Metabolic pathways
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04062  Chemokine signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04621  NOD-like receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04973  Carbohydrate digestion and absorption
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05142  Chagas disease
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05200  Pathways in cancer
Module
lve_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103078639 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103078639 (PLCB4)
   04310 Wnt signaling pathway
    103078639 (PLCB4)
   04371 Apelin signaling pathway
    103078639 (PLCB4)
   04020 Calcium signaling pathway
    103078639 (PLCB4)
   04070 Phosphatidylinositol signaling system
    103078639 (PLCB4)
   04072 Phospholipase D signaling pathway
    103078639 (PLCB4)
   04071 Sphingolipid signaling pathway
    103078639 (PLCB4)
   04022 cGMP-PKG signaling pathway
    103078639 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103078639 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103078639 (PLCB4)
   04613 Neutrophil extracellular trap formation
    103078639 (PLCB4)
   04621 NOD-like receptor signaling pathway
    103078639 (PLCB4)
   04062 Chemokine signaling pathway
    103078639 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    103078639 (PLCB4)
   04922 Glucagon signaling pathway
    103078639 (PLCB4)
   04929 GnRH secretion
    103078639 (PLCB4)
   04912 GnRH signaling pathway
    103078639 (PLCB4)
   04915 Estrogen signaling pathway
    103078639 (PLCB4)
   04921 Oxytocin signaling pathway
    103078639 (PLCB4)
   04926 Relaxin signaling pathway
    103078639 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    103078639 (PLCB4)
   04918 Thyroid hormone synthesis
    103078639 (PLCB4)
   04919 Thyroid hormone signaling pathway
    103078639 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    103078639 (PLCB4)
   04916 Melanogenesis
    103078639 (PLCB4)
   04924 Renin secretion
    103078639 (PLCB4)
   04925 Aldosterone synthesis and secretion
    103078639 (PLCB4)
   04927 Cortisol synthesis and secretion
    103078639 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103078639 (PLCB4)
   04270 Vascular smooth muscle contraction
    103078639 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    103078639 (PLCB4)
   04971 Gastric acid secretion
    103078639 (PLCB4)
   04972 Pancreatic secretion
    103078639 (PLCB4)
   04973 Carbohydrate digestion and absorption
    103078639 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103078639 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    103078639 (PLCB4)
   04725 Cholinergic synapse
    103078639 (PLCB4)
   04728 Dopaminergic synapse
    103078639 (PLCB4)
   04726 Serotonergic synapse
    103078639 (PLCB4)
   04720 Long-term potentiation
    103078639 (PLCB4)
   04730 Long-term depression
    103078639 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    103078639 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    103078639 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    103078639 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103078639 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103078639 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103078639 (PLCB4)
   05016 Huntington disease
    103078639 (PLCB4)
   05017 Spinocerebellar ataxia
    103078639 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    103078639 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103078639 (PLCB4)
   04934 Cushing syndrome
    103078639 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103078639 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103078639 (PLCB4)
   05142 Chagas disease
    103078639 (PLCB4)
   05143 African trypanosomiasis
    103078639 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103078639 (PLCB4)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103078639 (PLCB4)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103078639 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103078639 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 103078639
NCBI-ProteinID: XP_007452098
UniProt: A0A340WRF6
LinkDB
Position
Un
AA seq 1194 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSVRLGATPKDPKILAALEAIGKSENDLEGRVVCVCSGTDLVNISFTYMVAENSE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDTKRAMQIIEMYEPDEDLKKKGQISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVNILEDDNEEEIESAEQEEEAHPEYKYGNELSADDLGHKEAIANSVKKGLV
TIEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRLAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKASVTPQSSSELRPTTTAA
LGAGLEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSDMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSCVKLQDTN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaattggcagaaggaagttccttcgtttttgcaagaagga
gcagtttttgacagatatgaagaggaatcctttgtgtttgaacccaactgcctcttcaag
gtggatgaatttggcttctttctgacctggagaagtgaaggcaaggaaggacaagttcta
gaatgttctctcatcaacagtgttcgactgggagccacaccaaaggatcccaaaattttg
gctgctcttgaagctattggaaagtcagaaaatgacctggaagggcgggtagtttgtgtc
tgcagtggtacagatctggtgaacatcagtttcacatacatggtggctgaaaattcagaa
gtaactaagcaatgggtcgaaggcctgagatccatcatacacaacttcagggccaacaat
gtcagtcccatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatgggaaaattccagttaggagtattaccagaacctttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagctaggtcttcccagtggaaagaatgatgaaattgaa
cctgcagcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaggatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattc
ccattttatgatactaaaagggcaatgcagatcattgagatgtatgagcctgatgaagac
ttgaagaaaaaaggccaaatatcaagtgatgggttttgcagatacctgatgtcagatgaa
aatgccccagtcttcctagatcgcctagagctttaccaagaaatggaccaccctctggct
cactacttcatcagctcttcccacaacacctatctcactggcagacagtttggtggcaag
tcttcagtagaaatgtacagacaggtcctcctggctggttgcagatgtgttgaacttgac
tgttgggatggaaaaggtgaggaccaagaaccaataataactcatggaaaagcaatgtgc
acagatatcctttttaaggatgttattcaagccatcaaggaaactgcatttgtcacatct
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggagatctcctgttgaaacaagcacttgaatcacat
ccactggaaccaggcaggcctttgccatccccaaatgacctcaaaagaaaaatactcatc
aaaaataaacggctgaaacctgaggttgaaaaaaaacagcttgaagctttgaaaagtatg
atggaagcaggagaatccgctgccccagtgaacatcttagaggatgacaatgaagaggaa
atagaaagtgctgagcaagaggaagaagctcaccctgaatacaaatatggaaatgaactt
tctgcggacgacttgggtcacaaggaagctattgccaatagtgttaagaagggcctggta
actatagaagatgagcaggcatggatggcatcttataaatatgtaggcgccaccactaat
atccatccatatttgtccacaatgatcaactatgcacagcccgtaaagtttcaaggtttc
cacgtggctgaagaacgcaatattcattataacatgtcttcttttaatgagtcagttggt
ctaggctacttgaagacacatgcgattgaatttgtgaattataacaaacggcaaatgagc
cgcatttaccccaagggaggccgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcgctgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatg
agacggcccgatagaacatttgatcccttctctgaaacgcctgttgatggggttattgca
gccacttgctcagtgcaggtcatatcaggtcagttcttatcagataaaaaaattggcaca
tatgtagaagtggatatgtatgggttgcccaccgacactatccggaaggaattccgaaca
cgcatggtgatgaacaatggactcaatccagtttacaatgaagaatcatttgtatttcgg
aaggtgatcctccctgacctggcagtcttgagacttgcagtgtatgatgacaacaacaag
ctgattggccagaggattctgccactggatggcctccaagcaggctatcgacacatttct
cttcgaaatgagggaaataaacctttatcactgccaacaattttctgcaatattgttctt
aaaacatatgtgcctgatggatttggagatattgtggatgctttatcagatccaaagaaa
tttctttccattacggaaaagagagcagaccaaatgagagctatgggcattgaaactagt
gacatcgccgacgtgcccagtgacacgtcaaagaatgacaagaaagggaaagccaacaca
gcgaaagcaagtgtgacccctcagagcagctcagagctcaggcccaccaccacggctgcc
ctgggagctggcctggaggccaagaaaggtattgaactgatccctcaagtgaggatagaa
gatttaaagcagatgaaggcttacttgaagcatttaaagaaacaacagaaggagctcaat
tctttaaagaagaaacatgcaaaggagcacagtaccatgcagaagctacattgcacacaa
gttgacaaaattgtggcacagtatgacaaggagaagtcaactcatgagaaaatcctagag
aaggcaatgaagaagaaggggggaagtaattgtcttgaaatgaagaaagaaacagaaatt
aaaattcagacgctgacatcagatcacaaatctaaggtcaaggagatcgtggcgcagcac
acaaaagagtggtcagacatgatcaacacccacagtgcagaggagcaggagatccgggat
ctgcacctcagccagcagtgcgagctgctcaaaaagctcctgatcaacgcccacgagcag
cagacccagcagttgaaactgtcccatgacagggaaagcaaggaaatgcgagcacaccag
gctaagatttctatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgggaaaggcgggtcagggagttaaacagcagcaacactaaaaagtttctggaa
gaaagaaagcgactcgcaatgaagcagtccaaagaaatggaccagttgaaaaaagtccag
cttgaacacctcgaattcctagagaaacagaacgagcagcttttgaaatcctgtcatgca
gtgtcccaaacgcaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagttgtgtgaaactccaggacacaaactga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079287
Entry
103079287         CDS       T03090                                 

Gene name
PLCB1
Definition
(RefSeq) phospholipase C beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00562  Inositol phosphate metabolism
lve01100  Metabolic pathways
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04062  Chemokine signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04621  NOD-like receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04973  Carbohydrate digestion and absorption
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05142  Chagas disease
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05200  Pathways in cancer
Module
lve_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103079287 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103079287 (PLCB1)
   04310 Wnt signaling pathway
    103079287 (PLCB1)
   04371 Apelin signaling pathway
    103079287 (PLCB1)
   04020 Calcium signaling pathway
    103079287 (PLCB1)
   04070 Phosphatidylinositol signaling system
    103079287 (PLCB1)
   04072 Phospholipase D signaling pathway
    103079287 (PLCB1)
   04071 Sphingolipid signaling pathway
    103079287 (PLCB1)
   04022 cGMP-PKG signaling pathway
    103079287 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103079287 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103079287 (PLCB1)
   04613 Neutrophil extracellular trap formation
    103079287 (PLCB1)
   04621 NOD-like receptor signaling pathway
    103079287 (PLCB1)
   04062 Chemokine signaling pathway
    103079287 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    103079287 (PLCB1)
   04922 Glucagon signaling pathway
    103079287 (PLCB1)
   04929 GnRH secretion
    103079287 (PLCB1)
   04912 GnRH signaling pathway
    103079287 (PLCB1)
   04915 Estrogen signaling pathway
    103079287 (PLCB1)
   04921 Oxytocin signaling pathway
    103079287 (PLCB1)
   04926 Relaxin signaling pathway
    103079287 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    103079287 (PLCB1)
   04918 Thyroid hormone synthesis
    103079287 (PLCB1)
   04919 Thyroid hormone signaling pathway
    103079287 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    103079287 (PLCB1)
   04916 Melanogenesis
    103079287 (PLCB1)
   04924 Renin secretion
    103079287 (PLCB1)
   04925 Aldosterone synthesis and secretion
    103079287 (PLCB1)
   04927 Cortisol synthesis and secretion
    103079287 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103079287 (PLCB1)
   04270 Vascular smooth muscle contraction
    103079287 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    103079287 (PLCB1)
   04971 Gastric acid secretion
    103079287 (PLCB1)
   04972 Pancreatic secretion
    103079287 (PLCB1)
   04973 Carbohydrate digestion and absorption
    103079287 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103079287 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103079287 (PLCB1)
   04725 Cholinergic synapse
    103079287 (PLCB1)
   04728 Dopaminergic synapse
    103079287 (PLCB1)
   04726 Serotonergic synapse
    103079287 (PLCB1)
   04720 Long-term potentiation
    103079287 (PLCB1)
   04730 Long-term depression
    103079287 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    103079287 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    103079287 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    103079287 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103079287 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103079287 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103079287 (PLCB1)
   05016 Huntington disease
    103079287 (PLCB1)
   05017 Spinocerebellar ataxia
    103079287 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    103079287 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103079287 (PLCB1)
   04934 Cushing syndrome
    103079287 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103079287 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103079287 (PLCB1)
   05142 Chagas disease
    103079287 (PLCB1)
   05143 African trypanosomiasis
    103079287 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103079287 (PLCB1)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103079287 (PLCB1)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103079287 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103079287 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 103079287
NCBI-ProteinID: XP_007452101
UniProt: A0A340WT67
LinkDB
Position
Un
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQSKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDLIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVPPEKLDLNEDMSQPLTHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPLDLMYKILVKNKKKSHKSSEGSGKK
KLSEQTSNTYSDSSSVFEPSSPGAGEADTESDDDDDEDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNRSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLMLPALFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETQSEAPSEARTTPAENGMNHTTSLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKTAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHSSAPPLLTSDPGKLNHKPPSS
EKLEGENPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcagcccggagtacacgctctgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgtcactcca
attattttgaggaccgaccctcagggatttttcttttactggacagatcaaagcaaggag
acggagctgttagatctcagccttgtcaaagatgccagatgtgggaaacacgccaaggct
cccaaggaccccaaattacgtgaacttctggatgtggggaacatcgggcgcctggaacat
cgcatgataacagtggtgtatgggcctgacttagttaacatctcccatttgaacctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaagttttcagtctggcaacgaac
ctgctggcccaaaacatgtctagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaaggacgcattcctctcaaaaacatataccgcttgttctcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcgaggaatgat
ttgatacctcaagaagatttcaccccagaagtgtacagagttttcctgaacaacctttgt
cctcgacctgaaattgataacatcttttccgaatttggtgccaaaagtaaaccatacctt
acggttgatcagatgatggattttatcaacctcaagcagcgagatcccaggctaaatgaa
attctgtacccacctttaaagcaagagcaagtccaagtgttgattgagaagtatgaaccc
aacaacagtcttgccagaaaaggacagatatcagtggatggatttatgcgctatctgagt
ggagaagaaaatggagtcgttccacctgagaaactggatttgaatgaagatatgtctcag
ccacttactcactatttcattaattcctcacacaacacctacctcacagctggccagctg
gctggaaactcctccgtcgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagttggactgctggaagggacggaccgcagaagaggagccagtcatcacccatgggttc
accatgaccacggagatatccttcaaggaagtgatagaagccattgctgagtgtgcattt
aagacttcaccttttccaattctgctttcatttgagaaccacgtggattccccaaagcag
caggccaagatggcagagtattgccggctgatcttcggggacgcccttctcatggagccc
ctggaaaagtacccactggaatctggagttcctcttccaagccctctggacttaatgtac
aaaatcttggtgaaaaataagaagaaatcccacaaatcgtcagaaggaagtggcaaaaag
aagctctcagaacaaacctccaacacgtacagcgactcctccagtgtgtttgagccctcg
tccccaggagctggagaagctgatacggagagtgacgatgatgacgatgaggatgactgt
aaaaagtcttcgatggatgaggggactgctgggagcgaggccatggccacagaagagatg
tctaatctggtgaactatattcagccagtcaagttcgagtcattcgaaatttcaaaaaaa
agaaacagaagcttcgaaatgtcctcctttgtggaaaccaaaggacttgagcaacttaca
aagtccccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactacatgccccagctcttctggaatgcaggctgccaa
atggttgcacttaatttccaaacagtggacctggctatgcaaataaacatggggatgtat
gaatacaatgggaaaagtggctacagactgaagccagagttcatgaggagacctgacaag
cactttgatccattcaccgaaggcattgtggatgggatcgtggccaacactttatctgtt
aagattatttcaggtcagtttctctctgataagaaagtcgggacttatgtggaagtggat
atgtttggtttgcctgtggacacaaggaggaaggcatttaagacaaagacatcacaagga
aatgctgtaaatcctgtctgggaagaagaacccattgtgttcaaaaaggtagttcttcct
tctctggcctgtttgaggatagcagtttatgaagaaggaggtaaatttattggtcaccga
atcttgccagtacaagcgattcgaccaggctatcactacatctgtctgaggaatgaaagg
aaccagcctctgatgctgccagctctcttcgtctacatagaggtgaaggactatgtccca
gatacatatgcagatgtgattgaagctttgtcaaatccaatccgatatgtgaatctgatg
gagcagagagctaaacaactggcagctttgactctggaagatgaagaagaagtaaagaaa
gaggctgatcctggggaaacacagtcagaagctccaagtgaagccaggacaactccagca
gaaaacgggatgaatcacactacatccctgacacccaaaccaccctcccaggctctccac
agccaaccagctccaggctctgtaaaggcacctgccaaaacagaagatcttattcagagt
gttttaacagaagtagaggcgcagacaattgaagagctaaagcaacagaagtcgtttgtg
aaacttcaaaagaagcactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accaccgaccttatcaaagaacacactacaaaatataatgaaatccagaatgactacttg
cgaaggagggcagctttggaaaagacagccaaaaaggatagtaagaaaaaatcggaaccc
agcagccctgaccatggttcatcaacaattgagcaagaccttgctgccctggatgccgaa
atgacccaaaagttaatagatttgaaggacaaacaacagcagcagctgcttaatcttcga
caagaacagtattacagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aaattgacagatgttgctgaagaatgtcagaataatcagttaaagaagcttaaagaaatt
tgtgagaaagagaagaaggaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagccagatggaagaggaaaagacagagatgatccgg
tcatacatccaggaggtggtgcagtacatcaagaggttagaagaggcacaaagtaaacgg
caagaaaaactcgtagagaaacacaaagagatacgtcagcagatcctggacgaaaagccc
aagctgcaggtggagctagagcaggagtaccaagacaagttcaaaaggctgcctctggag
attttggaattcgtgcaagaagccatgaaagggaagatcagtgaagacagcaatcacagc
tctgcccctcccctgctgacctcagaccctggaaaactgaaccacaagcctccttccagt
gagaagctggaaggagaaaacccaggaaaagaatttgatactcccctgtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083884
Entry
103083884         CDS       T03090                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00562  Inositol phosphate metabolism
lve01100  Metabolic pathways
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04062  Chemokine signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04621  NOD-like receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04973  Carbohydrate digestion and absorption
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05142  Chagas disease
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05200  Pathways in cancer
Module
lve_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103083884 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103083884 (PLCB3)
   04310 Wnt signaling pathway
    103083884 (PLCB3)
   04371 Apelin signaling pathway
    103083884 (PLCB3)
   04020 Calcium signaling pathway
    103083884 (PLCB3)
   04070 Phosphatidylinositol signaling system
    103083884 (PLCB3)
   04072 Phospholipase D signaling pathway
    103083884 (PLCB3)
   04071 Sphingolipid signaling pathway
    103083884 (PLCB3)
   04022 cGMP-PKG signaling pathway
    103083884 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103083884 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103083884 (PLCB3)
   04613 Neutrophil extracellular trap formation
    103083884 (PLCB3)
   04621 NOD-like receptor signaling pathway
    103083884 (PLCB3)
   04062 Chemokine signaling pathway
    103083884 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    103083884 (PLCB3)
   04922 Glucagon signaling pathway
    103083884 (PLCB3)
   04929 GnRH secretion
    103083884 (PLCB3)
   04912 GnRH signaling pathway
    103083884 (PLCB3)
   04915 Estrogen signaling pathway
    103083884 (PLCB3)
   04921 Oxytocin signaling pathway
    103083884 (PLCB3)
   04926 Relaxin signaling pathway
    103083884 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    103083884 (PLCB3)
   04918 Thyroid hormone synthesis
    103083884 (PLCB3)
   04919 Thyroid hormone signaling pathway
    103083884 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    103083884 (PLCB3)
   04916 Melanogenesis
    103083884 (PLCB3)
   04924 Renin secretion
    103083884 (PLCB3)
   04925 Aldosterone synthesis and secretion
    103083884 (PLCB3)
   04927 Cortisol synthesis and secretion
    103083884 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103083884 (PLCB3)
   04270 Vascular smooth muscle contraction
    103083884 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    103083884 (PLCB3)
   04971 Gastric acid secretion
    103083884 (PLCB3)
   04972 Pancreatic secretion
    103083884 (PLCB3)
   04973 Carbohydrate digestion and absorption
    103083884 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103083884 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    103083884 (PLCB3)
   04725 Cholinergic synapse
    103083884 (PLCB3)
   04728 Dopaminergic synapse
    103083884 (PLCB3)
   04726 Serotonergic synapse
    103083884 (PLCB3)
   04720 Long-term potentiation
    103083884 (PLCB3)
   04730 Long-term depression
    103083884 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    103083884 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    103083884 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    103083884 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103083884 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103083884 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103083884 (PLCB3)
   05016 Huntington disease
    103083884 (PLCB3)
   05017 Spinocerebellar ataxia
    103083884 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    103083884 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103083884 (PLCB3)
   04934 Cushing syndrome
    103083884 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103083884 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103083884 (PLCB3)
   05142 Chagas disease
    103083884 (PLCB3)
   05143 African trypanosomiasis
    103083884 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103083884 (PLCB3)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103083884 (PLCB3)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103083884 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103083884 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Other DBs
NCBI-GeneID: 103083884
NCBI-ProteinID: XP_007462136
UniProt: A0A340XL55
LinkDB
Position
Un
AA seq 1230 aa
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPSGFFLYWTGPNME
VDILDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTSFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEAGLEKPSLEPQKSLGE
ESLQRGPDALGSAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNRCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLALLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQAGPETSQETQSQQP
GSQLTPNPTPSPLDTSPRRPPGPVTSSTSTSLSSPGQRDDLIASVLSEVAPAPLDELRGH
KALVKLQSRQERDFRELHKKHQRKAVALTRRLLDNLAQAQAESRCRHRPGVLGGEDEREE
EEEVKRYQEFQKKQVQRLLELREAQADTEAERRLEHLRQAQQRLREIVMDAHITQFKRLK
EMNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEEAQK
QRQERLVAAQQQILQQLTEEEPKLLAQLAQECQEQRERLPREIRRSLLGETPEGLGDGHL
VACASNGHAPGSSGHLSGADSESQEETTKL
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctggagccgcccaccgtcgtggag
accctgcggcgtgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtaactctgcgcgtggaccctagtggcttcttcctgtactggacagggcccaacatggag
gtggacatactggacatcagttccatcagggacacgaggacaggccgttatgcccgccta
cccaaggaccccaagattcgggaggtgttgggctttgggggccctgatgcccggttggag
gaaaagttgatgacagtggtggccgggccagacccggtgaatacatcgtttttgaacttc
atggccgtgcaggatgacacagccaaggtctggtccgaggagctgttcaagctggctatg
aacatcctggctcagaatgcctcccggaacaccttcttgcgcaaagcgtacacgaagctg
aaactgcaggtgaaccaggatggacggatcccggtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtagaaactgcactggaatcctgtggcctcaatttcaaccggagc
gagtccatccggcctgacgagttttccttggaaatcttcgagcggttcttgaacaagctt
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaaaccatac
ctgacactggagcagctcatggacttcatcaaccagaagcaacgggacccgaggctcaat
gaggtgctgtacccgcctctgcggccctcccaggcccggctgcttatcgagaagtatgag
cccaaccagcagttcctggagagagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaggagaacggcatcctgcccctagaggctctggatctgagcgcagacatgacc
cagccgctcagcgcctatttcatcaactcctcacacaacacctatctcactgcggggcag
ctggcgggaacctcgtcggtggagatgtaccggcaggcactgctgtggggctgccgctgc
gtggagctggacgtgtggaaagggcggccgcctgaggaggagcccttcatcacccacggc
ttcaccatgaccacggaggtgccgctgcgagatgtgctggaggccattgcggagactgcc
ttcaagacctcaccctaccctgtcatcctctcctttgagaaccatgtggactcggcaaag
cagcaggccaagatggctgagtactgccgctccatctttggggacgcgctgctcatcgac
cccctggacaagtacccgctggccccgggcgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccggcccagcactggcgttcctgacagc
tccgtgcgcaagcggccgctagagcagagcaactcggccctgagcgagagctccgccgcc
accgagccctcctcaccccagctcgggtcccccagctctgacagctgcccaggcctgagc
aatggggaggaggcgggccttgagaagcccagcctggagcctcagaagtctctgggtgag
gagagtttgcagcggggccctgatgcccttggatctgcctaccgtgaggatgaggaagag
gatgaggaagaggaggaacagacggatcccaaaaagccgaccaccgacgagggcactgcc
agcagtgaggtcaatgccactgaggaaatgtcgacacttgtcaactacatcgagcccgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaggtgcttcgagatgtcgtccttt
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacacgcgtggactcgtccaactacatg
ccccagctcttctggaacgtgggctgccagctcgtcgcgctcaacttccagaccctggac
gtggccatgcagctcaacgcgggcgtgttcgagtacaacgggcgcagtggctacctactc
aagcccgagttcatgcggcggccggacaagtcctttgaccccttcactgaggtcatcgtg
gacggcatcgtggccaatgccgtgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggatatgttcggcctccctgtcgacacgcggcgc
aagtaccgcactcggacctctcaggggaactcgttcaaccccgtgtgggatgaggagccc
ttcgatttccccaaggtggtgctgcccacgctggctttgctgcgcatcgcggcttttgag
gagggtggcaagttcgtggggcaccggatcctgcctgtctctgccatccgctcagggtac
cactacatctgcctgcggaacgaggccaaccagccactgtgcctgccggccctgctcatc
tacactgaggcctctgactatattcctgatgaccaccaagactacgcagaggccctgatc
aatcccatcaagcacgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagtgaggctcaggctgggccggagacaagccaggagacccagtctcagcagcca
gggtcccagctgaccccaaaccccacacccagcccactggacacctccccccgccggccc
ccaggccccgtcacctcctccaccagcacctccctcagcagcccaggtcagcgtgatgac
ctcattgccagcgtcctctcagaggtggccccggccccgctggatgagctccgaggccac
aaggccctggtgaagctccagagccggcaagagcgagactttcgagagctgcacaagaag
catcagcggaaggcggttgccctcacacgccggttgctcgacaacctggcccaggcccag
gccgagagcaggtgccggcaccggccgggtgtcctaggcggggaggacgagagggaggag
gaggaagaggtgaagaggtatcaagagttccaaaagaagcaggtgcagcgtctgctggag
ctgagggaggcccaggcggacacagaggccgagcggaggctggagcacctgagacaggct
cagcagaggctcagggagattgtcatggatgctcacatcactcagttcaagagactgaag
gagatgaacgagagggagaagaaggaactgcagaagatcctggacaggaagcgccacaac
agtatctcagaggcaaagaccagggagaaacataagaaggaggcggaactgacagagatt
aaccgtcgacacatcactgagtcggtcaactccatccgtcggctggaggaggcccagaag
cagcggcaggaacgccttgtggccgcgcagcagcagattctccaacagctgacagaagag
gagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgggagaggctgccc
cgggagatccgccggagcctgctgggcgagacgccggagggactgggggacgggcatctg
gtggcctgtgccagcaatggtcacgcgcctgggagcagtgggcacctgtccggcgctgat
tcggagagtcaagaggagactacgaagctctga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103086280
Entry
103086280         CDS       T03090                                 

Gene name
PLCB2
Definition
(RefSeq) phospholipase C beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00562  Inositol phosphate metabolism
lve01100  Metabolic pathways
lve04015  Rap1 signaling pathway
lve04020  Calcium signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04062  Chemokine signaling pathway
lve04070  Phosphatidylinositol signaling system
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04270  Vascular smooth muscle contraction
lve04310  Wnt signaling pathway
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04611  Platelet activation
lve04613  Neutrophil extracellular trap formation
lve04621  NOD-like receptor signaling pathway
lve04713  Circadian entrainment
lve04720  Long-term potentiation
lve04723  Retrograde endocannabinoid signaling
lve04724  Glutamatergic synapse
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04728  Dopaminergic synapse
lve04730  Long-term depression
lve04742  Taste transduction
lve04750  Inflammatory mediator regulation of TRP channels
lve04911  Insulin secretion
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04918  Thyroid hormone synthesis
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04922  Glucagon signaling pathway
lve04924  Renin secretion
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve04961  Endocrine and other factor-regulated calcium reabsorption
lve04970  Salivary secretion
lve04971  Gastric acid secretion
lve04972  Pancreatic secretion
lve04973  Carbohydrate digestion and absorption
lve05010  Alzheimer disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05022  Pathways of neurodegeneration - multiple diseases
lve05142  Chagas disease
lve05143  African trypanosomiasis
lve05146  Amoebiasis
lve05163  Human cytomegalovirus infection
lve05200  Pathways in cancer
Module
lve_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103086280 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103086280 (PLCB2)
   04310 Wnt signaling pathway
    103086280 (PLCB2)
   04371 Apelin signaling pathway
    103086280 (PLCB2)
   04020 Calcium signaling pathway
    103086280 (PLCB2)
   04070 Phosphatidylinositol signaling system
    103086280 (PLCB2)
   04072 Phospholipase D signaling pathway
    103086280 (PLCB2)
   04071 Sphingolipid signaling pathway
    103086280 (PLCB2)
   04022 cGMP-PKG signaling pathway
    103086280 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103086280 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103086280 (PLCB2)
   04613 Neutrophil extracellular trap formation
    103086280 (PLCB2)
   04621 NOD-like receptor signaling pathway
    103086280 (PLCB2)
   04062 Chemokine signaling pathway
    103086280 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    103086280 (PLCB2)
   04922 Glucagon signaling pathway
    103086280 (PLCB2)
   04929 GnRH secretion
    103086280 (PLCB2)
   04912 GnRH signaling pathway
    103086280 (PLCB2)
   04915 Estrogen signaling pathway
    103086280 (PLCB2)
   04921 Oxytocin signaling pathway
    103086280 (PLCB2)
   04926 Relaxin signaling pathway
    103086280 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    103086280 (PLCB2)
   04918 Thyroid hormone synthesis
    103086280 (PLCB2)
   04919 Thyroid hormone signaling pathway
    103086280 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    103086280 (PLCB2)
   04916 Melanogenesis
    103086280 (PLCB2)
   04924 Renin secretion
    103086280 (PLCB2)
   04925 Aldosterone synthesis and secretion
    103086280 (PLCB2)
   04927 Cortisol synthesis and secretion
    103086280 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103086280 (PLCB2)
   04270 Vascular smooth muscle contraction
    103086280 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    103086280 (PLCB2)
   04971 Gastric acid secretion
    103086280 (PLCB2)
   04972 Pancreatic secretion
    103086280 (PLCB2)
   04973 Carbohydrate digestion and absorption
    103086280 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    103086280 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103086280 (PLCB2)
   04725 Cholinergic synapse
    103086280 (PLCB2)
   04728 Dopaminergic synapse
    103086280 (PLCB2)
   04726 Serotonergic synapse
    103086280 (PLCB2)
   04720 Long-term potentiation
    103086280 (PLCB2)
   04730 Long-term depression
    103086280 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    103086280 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    103086280 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    103086280 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103086280 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103086280 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103086280 (PLCB2)
   05016 Huntington disease
    103086280 (PLCB2)
   05017 Spinocerebellar ataxia
    103086280 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    103086280 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103086280 (PLCB2)
   04934 Cushing syndrome
    103086280 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103086280 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103086280 (PLCB2)
   05142 Chagas disease
    103086280 (PLCB2)
   05143 African trypanosomiasis
    103086280 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lve04131]
    103086280 (PLCB2)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     103086280 (PLCB2)
Membrane trafficking [BR:lve04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103086280 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    103086280 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y C2 EF-hand_like DUF1154 Caskin-Pro-rich AAA_13 Gp58
Other DBs
NCBI-GeneID: 103086280
NCBI-ProteinID: XP_007460267
UniProt: A0A340XJH6
LinkDB
Position
Un
AA seq 1420 aa
MSLLNPVLQPPGVKAYLSQGERFIRWDDETIASPVILRVDPKGYYLYWTYQNKEMEFLDI
TSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNNFLLKTLTVVSGPDMVDLTFHNFVSYKEN
VGKDWAEDVLALAKHPLMANASRSTFLDKSLVKLKMQLNPEGKIPVKNFFQMFPADRKRV
EAALSACHLPKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEHL
AKFINQKQRDSRLNSLLFPLARPDQVQGLIDKYEPRGINVQRGQLSPEGMVWFLCGPENS
VLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLAGCRCVELDCW
KGKPPDEEPIITHGFTMTTDIYFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKMA
EYCRTIFGDMLLTEPLEKFPLKPGIPLPSPEDLRGKILIKNKKKQFSGPPAPSQEPGGEA
EGSGPPNVPVGEDTVWAGEEGAELEEEEVEEEEEESGSLDEEGMKEMQSDEGTAGLEVTA
YKEMSSLVNYVQPTKFISFESSAQKNRSYVISSFTELKAYDLLSKSSVQFVDYNKRQMSR
IYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHEFMR
RLDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDSKRRYRTKL
SPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEDGNKFLGHRIIPINALNSGYHHLCL
HSESNMPLTMPALFVFLEMKDYVPDTWADLTVALANPIKFFSAHDKKSVKLKEAMGGLPE
NPFPLGSPVACQVNAASAPTSNGSAAAGAKAREEATKEAAEPRTASVEELRELKGVVKLQ
RRHEKELRELERRGARRWEELLQRGAAQRAELRPPGAGGGGDVRGRKLGPGKGSRKKRTP
PGEDPAGAVPAEGPEGAGARLRELRDRLELELLQQGEEQCECVLRCRAQQVAEQMTKMME
LAREKQAAELKILKETLETDTKEVKKKLEAKRLDRIQAMMKVTTDKMAQERLKREINNSH
IQEVVQVIKQMTENLENHQEKLEEKQAACLEQIREMEKQFQQEALAQYEAKMKGLEVEVK
ESVRTYLRACLPSVEEDKPERPCRVSRELCEQDALTEKTDAQESLLRCPHALGMFCKDIH
PSLGPLWISQPRATRPNPAELVQRDRRGGGAEELLTGLQYSRILRRPLQSPRLRTASFSA
AGSWQAGALSRMETSEIRARTPPPPPPRRISVCGRNNCVCVRDSLHFQWRFPARLRAPNP
AQRSCTDGGSPRLFRRAQGPASFYGAPGTDSGGGGGWGEKTVTLGLARSGACGPLRAAPA
PSPLPQPQGSAEEKLLPDVVAHREVGEGQGRSPPPRQFRP
NT seq 4263 nt   +upstreamnt  +downstreamnt
atgtctctgcttaaccctgtcctgcaaccccccggggtgaaggcctatctgagccaaggg
gagcgcttcatcagatgggatgatgaaacaatagcctccccggttatcctccgtgtggat
cccaagggctactacttgtactggacatatcagaataaggagatggagtttctggatatc
accagcatccgggacacacgctttgggaagtttgccaagatgcccaagagccagaagctc
cgggatgtctttaacatggactttcctgacaacaacttcctgctgaagacgctcaccgtg
gtgtctggccccgacatggtggacctcaccttccataacttcgtctcctacaaagagaac
gtgggcaaggactgggctgaagatgtcctggctctggccaagcacccgctgatggccaat
gcctcccgcagcaccttcctggacaagagcctggtgaaactcaagatgcagctcaacccc
gaaggaaagattcctgtgaagaattttttccagatgtttcctgctgaccgcaagcgggtg
gaagctgccctcagcgcctgccacctcccaaaaggcaagaatgatgccatcaatcccgag
gacttcccagaatccgtctacaagagtttcctcatgagcctttgtcctcggccagaaata
gatgagatcttcacttcctaccatgccaaggccaaaccctacatgactaaggagcacctg
gccaaattcatcaaccagaaacagcgcgactccaggctcaactccctgctgttcccgctt
gcgcggcctgaccaggtgcagggcctcatcgacaagtacgagcccagaggcatcaacgtg
cagaggggccagctgtcccccgagggcatggtatggttcctctgcggaccagagaacagc
gtgctggcccaggacaagctgctgctgcaccacgacatgacgcagccgctcaaccattac
ttcatcaactcctcccacaacacctacctgacagccggccagttctcaggcctttcctct
gccgagatgtaccgccaggtgctgctggcgggctgccgctgcgtggagctggactgctgg
aaggggaagccccctgacgaggagcccatcatcacccacggcttcaccatgaccacagac
atctatttcaaggaagcaattgaagctattgcagaaagtgcctttaagacctccccttat
ccggtcatcctgtcgtttgaaaaccacgtggactcaccccgccaacaggctaagatggcc
gagtactgccgaacgatatttggggatatgctgctcacagagccactggaaaagtttcca
ctgaaaccaggcatccccctgcccagccctgaggatctccgaggcaagatcctcatcaag
aacaagaagaagcagttttctggtcccccagcccccagccaggagccgggtggggaggct
gaggggagcggcccacccaatgtccctgtgggtgaggacacagtgtgggctggtgaggaa
ggggccgagctggaggaggaggaggtggaagaggaagaggaggagtcgggaagcctggat
gaagaagggatgaaggagatgcagtcagatgagggcacagcgggcctggaggtgacggct
tacaaggagatgtccagcctagtcaactacgtccaacccaccaagttcatctccttcgag
tcctctgcccagaagaaccgaagttatgtcatttcctccttcacggagctcaaggcttac
gacctgctctccaagtcctcagtgcagtttgtggactacaacaagcgccagatgagccgc
atctaccccaagggcacccgcatggactcctccaactacatgccccagatgttctggaat
gctggttgccagatggttgccctcaacttccagacgatggacctgcccatgcagcagaac
atggcgctctttgagttcaatgggcagagtggctacctcctcaagcacgagttcatgcgt
cggttagacaagcagttcaaccccttctcggtggaccgcatcgacgtggtggtagccacc
accctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgcacctat
gtggaagtggagctgtttggccttcctggggactccaagaggcgctatcgcaccaagctg
tcacccagtaccaattccatcaatcctgtctggaaggaggagccctttgtctttgaaaag
atcttgatgcctgagctggcctccctcagggtggctgtgatggaggacggcaacaagttt
cttggacaccgcataatccccatcaatgccctgaattctggataccaccatctgtgcctg
cacagcgagagcaacatgccgctcaccatgcctgcactctttgtcttcctggagatgaag
gactatgtacctgacacctgggcagatctcacggtggccctcgccaatcccatcaagttc
ttcagtgcccatgataagaagtctgtgaagctcaaggaagccatgggaggcctgcctgag
aatcccttccctctcgggagtccagttgcctgccaggtcaatgcggcatcagctccaacg
agcaacgggtcagcagcagccggggccaaggccagggaggaggccacgaaagaagctgcg
gagccgcggaccgccagcgtggaggagctgcgggagctgaagggcgtcgtgaagctgcag
cggcggcacgagaaggagctgcgggagctggagcggcgcggcgcgcggcgctgggaggag
ctgctgcagaggggcgcagcgcagcgggccgagctccggccgccgggcgctgggggcggc
ggcgacgtccggggccgcaagctcggcccggggaaaggctcccgcaaaaagaggaccccg
ccgggcgaggaccccgccggggcggtgccggccgaaggccccgagggcgcgggcgcgcgt
ctgcgagagctgagggacaggctggagctggagctgctgcagcagggcgaggagcagtgc
gagtgtgtcctgaggtgcagggcgcagcaagtggccgagcaaatgaccaagatgatggag
ctggccagagagaaacaggctgcagagctgaagatcctcaaggagactttggagactgac
accaaggaggtgaagaaaaagctggaggccaagaggctggatcggatccaggccatgatg
aaggtcaccacagacaagatggctcaggagaggttgaagagagagattaacaactcccat
atccaggaggtggtgcaggtcatcaagcagatgacggagaacctggagaatcaccaggag
aagctggaagagaagcaggcagcctgcctggaacagatccgggagatggaaaagcagttc
cagcaggaggcgctggcacagtacgaggccaagatgaagggcctggaggtggaagtgaag
gagtcggtgaggacctacctcagggcctgcttgccctctgtggaggaggacaagcctgag
aggccctgcagggtctccagagagctgtgtgagcaggatgcactcacagagaagacagat
gcccaggagagcctcctccgatgcccccatgcccttgggatgttctgcaaagacattcac
ccttctctgggacctctctggatctcccagccacgtgccaccaggcccaaccctgctgag
ctggtgcaacgtgacaggcggggaggcggcgccgaggagttgctaacggggctgcagtac
tcccggatcttaaggcgcccgctccagtcgccgcgtctccgcaccgccagcttctcagcc
gccgggagctggcaggcgggcgcgttgtctcggatggagacgtccgagatacgagcgcgc
actcccccaccgccacccccgcgccgaatcagcgtgtgcgggaggaacaattgtgtgtgc
gtgcgtgattcgctacacttccagtggcggttcccagccagactgagagcccccaacccc
gcgcagcgtagctgcaccgatgggggcagccctcgtctttttcgacgggctcagggtccc
gccagtttctatggagccccgggcaccgactccggtgggggcggagggtggggagagaag
actgtgactttgggattggcccggtcgggtgcatgtggccccctgcgagcagcccccgcc
ccgtccccgctgccgcagccccagggaagcgcggaggagaagctgctccccgacgtcgtg
gcccaccgagaggtgggtgaaggtcaggggcggtctccgccgccccgtcagtttcggccc
tga

DBGET integrated database retrieval system