Lipotes vexillifer (Yangtze River dolphin): 103078792 Help Entry 103078792         CDS       T03090                                  Gene name MAPK10 Definition (RefSeq) mitogen-activated protein kinase 10   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism lve  Lipotes vexillifer (Yangtze River dolphin) Pathway lve01522   Endocrine resistance lve04010   MAPK signaling pathway lve04012   ErbB signaling pathway lve04014   Ras signaling pathway lve04024   cAMP signaling pathway lve04068   FoxO signaling pathway lve04071   Sphingolipid signaling pathway lve04137   Mitophagy - animal lve04140   Autophagy - animal lve04141   Protein processing in endoplasmic reticulum lve04210   Apoptosis lve04215   Apoptosis - multiple species lve04217   Necroptosis lve04310   Wnt signaling pathway lve04380   Osteoclast differentiation lve04510   Focal adhesion lve04530   Tight junction lve04620   Toll-like receptor signaling pathway lve04621   NOD-like receptor signaling pathway lve04622   RIG-I-like receptor signaling pathway lve04625   C-type lectin receptor signaling pathway lve04657   IL-17 signaling pathway lve04658   Th1 and Th2 cell differentiation lve04659   Th17 cell differentiation lve04660   T cell receptor signaling pathway lve04664   Fc epsilon RI signaling pathway lve04668   TNF signaling pathway lve04722   Neurotrophin signaling pathway lve04723   Retrograde endocannabinoid signaling lve04728   Dopaminergic synapse lve04750   Inflammatory mediator regulation of TRP channels lve04910   Insulin signaling pathway lve04912   GnRH signaling pathway lve04914   Progesterone-mediated oocyte maturation lve04917   Prolactin signaling pathway lve04920   Adipocytokine signaling pathway lve04926   Relaxin signaling pathway lve04930   Type II diabetes mellitus lve04931   Insulin resistance lve04932   Non-alcoholic fatty liver disease lve04933   AGE-RAGE signaling pathway in diabetic complications lve04935   Growth hormone synthesis, secretion and action lve05010   Alzheimer disease lve05012   Parkinson disease lve05016   Huntington disease lve05017   Spinocerebellar ataxia lve05020   Prion disease lve05022   Pathways of neurodegeneration - multiple diseases lve05132   Salmonella infection lve05133   Pertussis lve05135   Yersinia infection lve05142   Chagas disease lve05145   Toxoplasmosis lve05152   Tuberculosis lve05161   Hepatitis B lve05162   Measles lve05166   Human T-cell leukemia virus 1 infection lve05167   Kaposi sarcoma-associated herpesvirus infection lve05169   Epstein-Barr virus infection lve05170   Human immunodeficiency virus 1 infection lve05171   Coronavirus disease - COVID-19 lve05200   Pathways in cancer lve05210   Colorectal cancer lve05212   Pancreatic cancer lve05231   Choline metabolism in cancer lve05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103078792 (MAPK10)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103078792 (MAPK10)    04012 ErbB signaling pathway     103078792 (MAPK10)    04014 Ras signaling pathway     103078792 (MAPK10)    04310 Wnt signaling pathway     103078792 (MAPK10)    04668 TNF signaling pathway     103078792 (MAPK10)    04068 FoxO signaling pathway     103078792 (MAPK10)    04071 Sphingolipid signaling pathway     103078792 (MAPK10)    04024 cAMP signaling pathway     103078792 (MAPK10)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103078792 (MAPK10)    04137 Mitophagy - animal     103078792 (MAPK10)   09143 Cell growth and death    04210 Apoptosis     103078792 (MAPK10)    04215 Apoptosis - multiple species     103078792 (MAPK10)    04217 Necroptosis     103078792 (MAPK10)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103078792 (MAPK10)    04530 Tight junction     103078792 (MAPK10)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103078792 (MAPK10)    04621 NOD-like receptor signaling pathway     103078792 (MAPK10)    04622 RIG-I-like receptor signaling pathway     103078792 (MAPK10)    04625 C-type lectin receptor signaling pathway     103078792 (MAPK10)    04660 T cell receptor signaling pathway     103078792 (MAPK10)    04658 Th1 and Th2 cell differentiation     103078792 (MAPK10)    04659 Th17 cell differentiation     103078792 (MAPK10)    04657 IL-17 signaling pathway     103078792 (MAPK10)    04664 Fc epsilon RI signaling pathway     103078792 (MAPK10)   09152 Endocrine system    04910 Insulin signaling pathway     103078792 (MAPK10)    04920 Adipocytokine signaling pathway     103078792 (MAPK10)    04912 GnRH signaling pathway     103078792 (MAPK10)    04914 Progesterone-mediated oocyte maturation     103078792 (MAPK10)    04917 Prolactin signaling pathway     103078792 (MAPK10)    04926 Relaxin signaling pathway     103078792 (MAPK10)    04935 Growth hormone synthesis, secretion and action     103078792 (MAPK10)   09156 Nervous system    04728 Dopaminergic synapse     103078792 (MAPK10)    04723 Retrograde endocannabinoid signaling     103078792 (MAPK10)    04722 Neurotrophin signaling pathway     103078792 (MAPK10)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103078792 (MAPK10)   09158 Development and regeneration    04380 Osteoclast differentiation     103078792 (MAPK10)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103078792 (MAPK10)    05231 Choline metabolism in cancer     103078792 (MAPK10)   09162 Cancer: specific types    05210 Colorectal cancer     103078792 (MAPK10)    05212 Pancreatic cancer     103078792 (MAPK10)   09164 Neurodegenerative disease    05010 Alzheimer disease     103078792 (MAPK10)    05012 Parkinson disease     103078792 (MAPK10)    05016 Huntington disease     103078792 (MAPK10)    05017 Spinocerebellar ataxia     103078792 (MAPK10)    05020 Prion disease     103078792 (MAPK10)    05022 Pathways of neurodegeneration - multiple diseases     103078792 (MAPK10)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103078792 (MAPK10)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103078792 (MAPK10)    04932 Non-alcoholic fatty liver disease     103078792 (MAPK10)    04931 Insulin resistance     103078792 (MAPK10)    04933 AGE-RAGE signaling pathway in diabetic complications     103078792 (MAPK10)   09171 Infectious disease: bacterial    05132 Salmonella infection     103078792 (MAPK10)    05135 Yersinia infection     103078792 (MAPK10)    05133 Pertussis     103078792 (MAPK10)    05152 Tuberculosis     103078792 (MAPK10)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103078792 (MAPK10)    05170 Human immunodeficiency virus 1 infection     103078792 (MAPK10)    05161 Hepatitis B     103078792 (MAPK10)    05171 Coronavirus disease - COVID-19     103078792 (MAPK10)    05162 Measles     103078792 (MAPK10)    05167 Kaposi sarcoma-associated herpesvirus infection     103078792 (MAPK10)    05169 Epstein-Barr virus infection     103078792 (MAPK10)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103078792 (MAPK10)    05142 Chagas disease     103078792 (MAPK10)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103078792 (MAPK10)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:lve01001]     103078792 (MAPK10) Enzymes [BR:lve01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103078792 (MAPK10) Protein kinases [BR:lve01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103078792 (MAPK10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  103078792 NCBI-ProteinID:  XP_007465771 UniProt:  A0A340XWQ9 LinkDB All DBs Position Un AA seq 464 aa AA seqDB search MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV LKRYQNLKPIGSGAQGIVCAAYDAALDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA VNTSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaacattcacagtt ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct gcgtatgatgctgctcttgacagaaatgtggccattaagaagctcagcagaccctttcag aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat aaaaacattattagtttattaaatgttttcacaccccagaaaacgctagaggagttccaa gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat tgtacattgaaaatcctagactttggactggccaggacagcaggcacaagcttcatgatg actccttatgtggtgacacgttattacagggcccccgaggttattctgggaatgggctac aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga acaccatgcccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat gtgtggtatgatcctgccgaagtggaggcgcccccaccccagatatacgacaaacagctg gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgaat tcagaagaaaagactaagaatggcgttgtgaaaggacagccttctccttcaggtgcagca gtgaacaccagtgagagcctccctccatcctcgtctgtcaacgatatctcctccatgtcc accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg ggttgttgcaggtga

Lipotes vexillifer (Yangtze River dolphin): 103084630 Help Entry 103084630         CDS       T03090                                  Gene name MAPK8 Definition (RefSeq) mitogen-activated protein kinase 8   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism lve  Lipotes vexillifer (Yangtze River dolphin) Pathway lve01522   Endocrine resistance lve04010   MAPK signaling pathway lve04012   ErbB signaling pathway lve04014   Ras signaling pathway lve04024   cAMP signaling pathway lve04068   FoxO signaling pathway lve04071   Sphingolipid signaling pathway lve04137   Mitophagy - animal lve04140   Autophagy - animal lve04141   Protein processing in endoplasmic reticulum lve04210   Apoptosis lve04215   Apoptosis - multiple species lve04217   Necroptosis lve04310   Wnt signaling pathway lve04380   Osteoclast differentiation lve04510   Focal adhesion lve04530   Tight junction lve04620   Toll-like receptor signaling pathway lve04621   NOD-like receptor signaling pathway lve04622   RIG-I-like receptor signaling pathway lve04625   C-type lectin receptor signaling pathway lve04657   IL-17 signaling pathway lve04658   Th1 and Th2 cell differentiation lve04659   Th17 cell differentiation lve04660   T cell receptor signaling pathway lve04664   Fc epsilon RI signaling pathway lve04668   TNF signaling pathway lve04722   Neurotrophin signaling pathway lve04723   Retrograde endocannabinoid signaling lve04728   Dopaminergic synapse lve04750   Inflammatory mediator regulation of TRP channels lve04910   Insulin signaling pathway lve04912   GnRH signaling pathway lve04914   Progesterone-mediated oocyte maturation lve04917   Prolactin signaling pathway lve04920   Adipocytokine signaling pathway lve04926   Relaxin signaling pathway lve04930   Type II diabetes mellitus lve04931   Insulin resistance lve04932   Non-alcoholic fatty liver disease lve04933   AGE-RAGE signaling pathway in diabetic complications lve04935   Growth hormone synthesis, secretion and action lve05010   Alzheimer disease lve05012   Parkinson disease lve05016   Huntington disease lve05017   Spinocerebellar ataxia lve05020   Prion disease lve05022   Pathways of neurodegeneration - multiple diseases lve05132   Salmonella infection lve05133   Pertussis lve05135   Yersinia infection lve05142   Chagas disease lve05145   Toxoplasmosis lve05152   Tuberculosis lve05161   Hepatitis B lve05162   Measles lve05166   Human T-cell leukemia virus 1 infection lve05167   Kaposi sarcoma-associated herpesvirus infection lve05169   Epstein-Barr virus infection lve05170   Human immunodeficiency virus 1 infection lve05171   Coronavirus disease - COVID-19 lve05200   Pathways in cancer lve05210   Colorectal cancer lve05212   Pancreatic cancer lve05231   Choline metabolism in cancer lve05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103084630 (MAPK8)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103084630 (MAPK8)    04012 ErbB signaling pathway     103084630 (MAPK8)    04014 Ras signaling pathway     103084630 (MAPK8)    04310 Wnt signaling pathway     103084630 (MAPK8)    04668 TNF signaling pathway     103084630 (MAPK8)    04068 FoxO signaling pathway     103084630 (MAPK8)    04071 Sphingolipid signaling pathway     103084630 (MAPK8)    04024 cAMP signaling pathway     103084630 (MAPK8)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103084630 (MAPK8)    04137 Mitophagy - animal     103084630 (MAPK8)   09143 Cell growth and death    04210 Apoptosis     103084630 (MAPK8)    04215 Apoptosis - multiple species     103084630 (MAPK8)    04217 Necroptosis     103084630 (MAPK8)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103084630 (MAPK8)    04530 Tight junction     103084630 (MAPK8)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103084630 (MAPK8)    04621 NOD-like receptor signaling pathway     103084630 (MAPK8)    04622 RIG-I-like receptor signaling pathway     103084630 (MAPK8)    04625 C-type lectin receptor signaling pathway     103084630 (MAPK8)    04660 T cell receptor signaling pathway     103084630 (MAPK8)    04658 Th1 and Th2 cell differentiation     103084630 (MAPK8)    04659 Th17 cell differentiation     103084630 (MAPK8)    04657 IL-17 signaling pathway     103084630 (MAPK8)    04664 Fc epsilon RI signaling pathway     103084630 (MAPK8)   09152 Endocrine system    04910 Insulin signaling pathway     103084630 (MAPK8)    04920 Adipocytokine signaling pathway     103084630 (MAPK8)    04912 GnRH signaling pathway     103084630 (MAPK8)    04914 Progesterone-mediated oocyte maturation     103084630 (MAPK8)    04917 Prolactin signaling pathway     103084630 (MAPK8)    04926 Relaxin signaling pathway     103084630 (MAPK8)    04935 Growth hormone synthesis, secretion and action     103084630 (MAPK8)   09156 Nervous system    04728 Dopaminergic synapse     103084630 (MAPK8)    04723 Retrograde endocannabinoid signaling     103084630 (MAPK8)    04722 Neurotrophin signaling pathway     103084630 (MAPK8)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103084630 (MAPK8)   09158 Development and regeneration    04380 Osteoclast differentiation     103084630 (MAPK8)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103084630 (MAPK8)    05231 Choline metabolism in cancer     103084630 (MAPK8)   09162 Cancer: specific types    05210 Colorectal cancer     103084630 (MAPK8)    05212 Pancreatic cancer     103084630 (MAPK8)   09164 Neurodegenerative disease    05010 Alzheimer disease     103084630 (MAPK8)    05012 Parkinson disease     103084630 (MAPK8)    05016 Huntington disease     103084630 (MAPK8)    05017 Spinocerebellar ataxia     103084630 (MAPK8)    05020 Prion disease     103084630 (MAPK8)    05022 Pathways of neurodegeneration - multiple diseases     103084630 (MAPK8)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103084630 (MAPK8)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103084630 (MAPK8)    04932 Non-alcoholic fatty liver disease     103084630 (MAPK8)    04931 Insulin resistance     103084630 (MAPK8)    04933 AGE-RAGE signaling pathway in diabetic complications     103084630 (MAPK8)   09171 Infectious disease: bacterial    05132 Salmonella infection     103084630 (MAPK8)    05135 Yersinia infection     103084630 (MAPK8)    05133 Pertussis     103084630 (MAPK8)    05152 Tuberculosis     103084630 (MAPK8)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103084630 (MAPK8)    05170 Human immunodeficiency virus 1 infection     103084630 (MAPK8)    05161 Hepatitis B     103084630 (MAPK8)    05171 Coronavirus disease - COVID-19     103084630 (MAPK8)    05162 Measles     103084630 (MAPK8)    05167 Kaposi sarcoma-associated herpesvirus infection     103084630 (MAPK8)    05169 Epstein-Barr virus infection     103084630 (MAPK8)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103084630 (MAPK8)    05142 Chagas disease     103084630 (MAPK8)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103084630 (MAPK8)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:lve01001]     103084630 (MAPK8) Enzymes [BR:lve01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103084630 (MAPK8) Protein kinases [BR:lve01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103084630 (MAPK8) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530 Motif Other DBs NCBI-GeneID:  103084630 NCBI-ProteinID:  XP_007446288 UniProt:  A0A340WA22 LinkDB All DBs Position Un AA seq 427 aa AA seqDB search MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA GPLGCCR NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaaa caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt atgatgacaccttatgtagtgactcgctactacagagcacctgaggtcatcctagggatg ggctacaaagaaaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc ccagctgactcggaacacaataaacttaaagccagtcaggcaagggatttgttatctaaa atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccgtat atcaacgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcctttaggt gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct ggacctctgggctgctgtagatga

Lipotes vexillifer (Yangtze River dolphin): 103087676 Help Entry 103087676         CDS       T03090                                  Gene name MAPK9 Definition (RefSeq) mitogen-activated protein kinase 9   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism lve  Lipotes vexillifer (Yangtze River dolphin) Pathway lve01522   Endocrine resistance lve04010   MAPK signaling pathway lve04012   ErbB signaling pathway lve04014   Ras signaling pathway lve04024   cAMP signaling pathway lve04068   FoxO signaling pathway lve04071   Sphingolipid signaling pathway lve04137   Mitophagy - animal lve04140   Autophagy - animal lve04141   Protein processing in endoplasmic reticulum lve04210   Apoptosis lve04215   Apoptosis - multiple species lve04217   Necroptosis lve04310   Wnt signaling pathway lve04380   Osteoclast differentiation lve04510   Focal adhesion lve04530   Tight junction lve04620   Toll-like receptor signaling pathway lve04621   NOD-like receptor signaling pathway lve04622   RIG-I-like receptor signaling pathway lve04625   C-type lectin receptor signaling pathway lve04657   IL-17 signaling pathway lve04658   Th1 and Th2 cell differentiation lve04659   Th17 cell differentiation lve04660   T cell receptor signaling pathway lve04664   Fc epsilon RI signaling pathway lve04668   TNF signaling pathway lve04722   Neurotrophin signaling pathway lve04723   Retrograde endocannabinoid signaling lve04728   Dopaminergic synapse lve04750   Inflammatory mediator regulation of TRP channels lve04910   Insulin signaling pathway lve04912   GnRH signaling pathway lve04914   Progesterone-mediated oocyte maturation lve04917   Prolactin signaling pathway lve04920   Adipocytokine signaling pathway lve04926   Relaxin signaling pathway lve04930   Type II diabetes mellitus lve04931   Insulin resistance lve04932   Non-alcoholic fatty liver disease lve04933   AGE-RAGE signaling pathway in diabetic complications lve04935   Growth hormone synthesis, secretion and action lve05010   Alzheimer disease lve05012   Parkinson disease lve05016   Huntington disease lve05017   Spinocerebellar ataxia lve05020   Prion disease lve05022   Pathways of neurodegeneration - multiple diseases lve05132   Salmonella infection lve05133   Pertussis lve05135   Yersinia infection lve05142   Chagas disease lve05145   Toxoplasmosis lve05152   Tuberculosis lve05161   Hepatitis B lve05162   Measles lve05166   Human T-cell leukemia virus 1 infection lve05167   Kaposi sarcoma-associated herpesvirus infection lve05169   Epstein-Barr virus infection lve05170   Human immunodeficiency virus 1 infection lve05171   Coronavirus disease - COVID-19 lve05200   Pathways in cancer lve05210   Colorectal cancer lve05212   Pancreatic cancer lve05231   Choline metabolism in cancer lve05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103087676 (MAPK9)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103087676 (MAPK9)    04012 ErbB signaling pathway     103087676 (MAPK9)    04014 Ras signaling pathway     103087676 (MAPK9)    04310 Wnt signaling pathway     103087676 (MAPK9)    04668 TNF signaling pathway     103087676 (MAPK9)    04068 FoxO signaling pathway     103087676 (MAPK9)    04071 Sphingolipid signaling pathway     103087676 (MAPK9)    04024 cAMP signaling pathway     103087676 (MAPK9)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103087676 (MAPK9)    04137 Mitophagy - animal     103087676 (MAPK9)   09143 Cell growth and death    04210 Apoptosis     103087676 (MAPK9)    04215 Apoptosis - multiple species     103087676 (MAPK9)    04217 Necroptosis     103087676 (MAPK9)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103087676 (MAPK9)    04530 Tight junction     103087676 (MAPK9)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103087676 (MAPK9)    04621 NOD-like receptor signaling pathway     103087676 (MAPK9)    04622 RIG-I-like receptor signaling pathway     103087676 (MAPK9)    04625 C-type lectin receptor signaling pathway     103087676 (MAPK9)    04660 T cell receptor signaling pathway     103087676 (MAPK9)    04658 Th1 and Th2 cell differentiation     103087676 (MAPK9)    04659 Th17 cell differentiation     103087676 (MAPK9)    04657 IL-17 signaling pathway     103087676 (MAPK9)    04664 Fc epsilon RI signaling pathway     103087676 (MAPK9)   09152 Endocrine system    04910 Insulin signaling pathway     103087676 (MAPK9)    04920 Adipocytokine signaling pathway     103087676 (MAPK9)    04912 GnRH signaling pathway     103087676 (MAPK9)    04914 Progesterone-mediated oocyte maturation     103087676 (MAPK9)    04917 Prolactin signaling pathway     103087676 (MAPK9)    04926 Relaxin signaling pathway     103087676 (MAPK9)    04935 Growth hormone synthesis, secretion and action     103087676 (MAPK9)   09156 Nervous system    04728 Dopaminergic synapse     103087676 (MAPK9)    04723 Retrograde endocannabinoid signaling     103087676 (MAPK9)    04722 Neurotrophin signaling pathway     103087676 (MAPK9)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103087676 (MAPK9)   09158 Development and regeneration    04380 Osteoclast differentiation     103087676 (MAPK9)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103087676 (MAPK9)    05231 Choline metabolism in cancer     103087676 (MAPK9)   09162 Cancer: specific types    05210 Colorectal cancer     103087676 (MAPK9)    05212 Pancreatic cancer     103087676 (MAPK9)   09164 Neurodegenerative disease    05010 Alzheimer disease     103087676 (MAPK9)    05012 Parkinson disease     103087676 (MAPK9)    05016 Huntington disease     103087676 (MAPK9)    05017 Spinocerebellar ataxia     103087676 (MAPK9)    05020 Prion disease     103087676 (MAPK9)    05022 Pathways of neurodegeneration - multiple diseases     103087676 (MAPK9)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103087676 (MAPK9)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     103087676 (MAPK9)    04932 Non-alcoholic fatty liver disease     103087676 (MAPK9)    04931 Insulin resistance     103087676 (MAPK9)    04933 AGE-RAGE signaling pathway in diabetic complications     103087676 (MAPK9)   09171 Infectious disease: bacterial    05132 Salmonella infection     103087676 (MAPK9)    05135 Yersinia infection     103087676 (MAPK9)    05133 Pertussis     103087676 (MAPK9)    05152 Tuberculosis     103087676 (MAPK9)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103087676 (MAPK9)    05170 Human immunodeficiency virus 1 infection     103087676 (MAPK9)    05161 Hepatitis B     103087676 (MAPK9)    05171 Coronavirus disease - COVID-19     103087676 (MAPK9)    05162 Measles     103087676 (MAPK9)    05167 Kaposi sarcoma-associated herpesvirus infection     103087676 (MAPK9)    05169 Epstein-Barr virus infection     103087676 (MAPK9)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103087676 (MAPK9)    05142 Chagas disease     103087676 (MAPK9)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103087676 (MAPK9)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:lve01001]     103087676 (MAPK9) Enzymes [BR:lve01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103087676 (MAPK9) Protein kinases [BR:lve01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103087676 (MAPK9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 Motif Other DBs NCBI-GeneID:  103087676 NCBI-ProteinID:  XP_007465571 UniProt:  A0A340XW31 LinkDB All DBs Position Un AA seq 424 aa AA seqDB search MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ LGTPSSDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtc tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct tttcagaatcagactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc aatcataaaaatataattagcttgttaaatgtgtttacaccacagaaaactctagaagaa tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa catctacattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaag tcagactgtacccttaagatccttgactttggcctggctcgcacagcatgcaccaacttt atgatgaccccctacgtggtaacgcggtattatcgggcacctgaagtcatcctgggcatg ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag ctaggaacaccatcttcagatttcatgaagaaacttcagccaactgtgaggaattatgta gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttactatcaaaa atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat atcactgtttggtatgaccctgctgaagcagaagcgccaccacctcaaatttatgatgcc cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta atggattgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcagca gtaagtagcaacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc actgagcagacgctggcctcagacacagacagcagtctggatgcctcaacaggacccctt gaaggttgtcgatga

DBGET integrated database retrieval system