KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078792
Entry
103078792         CDS       T03090                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04137  Mitophagy - animal
lve04140  Autophagy - animal
lve04141  Protein processing in endoplasmic reticulum
lve04210  Apoptosis
lve04215  Apoptosis - multiple species
lve04217  Necroptosis
lve04310  Wnt signaling pathway
lve04380  Osteoclast differentiation
lve04510  Focal adhesion
lve04530  Tight junction
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04920  Adipocytokine signaling pathway
lve04926  Relaxin signaling pathway
lve04930  Type II diabetes mellitus
lve04931  Insulin resistance
lve04932  Non-alcoholic fatty liver disease
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05162  Measles
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05231  Choline metabolism in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103078792 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103078792 (MAPK10)
   04012 ErbB signaling pathway
    103078792 (MAPK10)
   04014 Ras signaling pathway
    103078792 (MAPK10)
   04310 Wnt signaling pathway
    103078792 (MAPK10)
   04668 TNF signaling pathway
    103078792 (MAPK10)
   04068 FoxO signaling pathway
    103078792 (MAPK10)
   04071 Sphingolipid signaling pathway
    103078792 (MAPK10)
   04024 cAMP signaling pathway
    103078792 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103078792 (MAPK10)
   04137 Mitophagy - animal
    103078792 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    103078792 (MAPK10)
   04215 Apoptosis - multiple species
    103078792 (MAPK10)
   04217 Necroptosis
    103078792 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103078792 (MAPK10)
   04530 Tight junction
    103078792 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103078792 (MAPK10)
   04621 NOD-like receptor signaling pathway
    103078792 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    103078792 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    103078792 (MAPK10)
   04660 T cell receptor signaling pathway
    103078792 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    103078792 (MAPK10)
   04659 Th17 cell differentiation
    103078792 (MAPK10)
   04657 IL-17 signaling pathway
    103078792 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    103078792 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103078792 (MAPK10)
   04920 Adipocytokine signaling pathway
    103078792 (MAPK10)
   04912 GnRH signaling pathway
    103078792 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    103078792 (MAPK10)
   04917 Prolactin signaling pathway
    103078792 (MAPK10)
   04926 Relaxin signaling pathway
    103078792 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    103078792 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    103078792 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    103078792 (MAPK10)
   04722 Neurotrophin signaling pathway
    103078792 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103078792 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103078792 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103078792 (MAPK10)
   05231 Choline metabolism in cancer
    103078792 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103078792 (MAPK10)
   05212 Pancreatic cancer
    103078792 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103078792 (MAPK10)
   05012 Parkinson disease
    103078792 (MAPK10)
   05016 Huntington disease
    103078792 (MAPK10)
   05017 Spinocerebellar ataxia
    103078792 (MAPK10)
   05020 Prion disease
    103078792 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    103078792 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103078792 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103078792 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    103078792 (MAPK10)
   04931 Insulin resistance
    103078792 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103078792 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103078792 (MAPK10)
   05135 Yersinia infection
    103078792 (MAPK10)
   05133 Pertussis
    103078792 (MAPK10)
   05152 Tuberculosis
    103078792 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103078792 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    103078792 (MAPK10)
   05161 Hepatitis B
    103078792 (MAPK10)
   05171 Coronavirus disease - COVID-19
    103078792 (MAPK10)
   05162 Measles
    103078792 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103078792 (MAPK10)
   05169 Epstein-Barr virus infection
    103078792 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103078792 (MAPK10)
   05142 Chagas disease
    103078792 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103078792 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103078792 (MAPK10)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103078792 (MAPK10)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103078792 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103078792
NCBI-ProteinID: XP_007465771
UniProt: A0A340XWQ9
LinkDB
Position
Un
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAALDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNTSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagcgtggaagtgggagactcaacattcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggaatagtttgtgct
gcgtatgatgctgctcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgttttcacaccccagaaaacgctagaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggag
ttagaccacgagcgaatgtcttacctgctataccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggacttgaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctagactttggactggccaggacagcaggcacaagcttcatgatg
actccttatgtggtgacacgttattacagggcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgagcaactagga
acaccatgcccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggacgacgccttacagcatccgtacatcaat
gtgtggtatgatcctgccgaagtggaggcgcccccaccccagatatacgacaaacagctg
gatgaaagagaacacaccattgaagaatggaaagaacttatttacaaggaagtcatgaat
tcagaagaaaagactaagaatggcgttgtgaaaggacagccttctccttcaggtgcagca
gtgaacaccagtgagagcctccctccatcctcgtctgtcaacgatatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103084630
Entry
103084630         CDS       T03090                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04137  Mitophagy - animal
lve04140  Autophagy - animal
lve04141  Protein processing in endoplasmic reticulum
lve04210  Apoptosis
lve04215  Apoptosis - multiple species
lve04217  Necroptosis
lve04310  Wnt signaling pathway
lve04380  Osteoclast differentiation
lve04510  Focal adhesion
lve04530  Tight junction
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04920  Adipocytokine signaling pathway
lve04926  Relaxin signaling pathway
lve04930  Type II diabetes mellitus
lve04931  Insulin resistance
lve04932  Non-alcoholic fatty liver disease
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05162  Measles
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05231  Choline metabolism in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103084630 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103084630 (MAPK8)
   04012 ErbB signaling pathway
    103084630 (MAPK8)
   04014 Ras signaling pathway
    103084630 (MAPK8)
   04310 Wnt signaling pathway
    103084630 (MAPK8)
   04668 TNF signaling pathway
    103084630 (MAPK8)
   04068 FoxO signaling pathway
    103084630 (MAPK8)
   04071 Sphingolipid signaling pathway
    103084630 (MAPK8)
   04024 cAMP signaling pathway
    103084630 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103084630 (MAPK8)
   04137 Mitophagy - animal
    103084630 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    103084630 (MAPK8)
   04215 Apoptosis - multiple species
    103084630 (MAPK8)
   04217 Necroptosis
    103084630 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103084630 (MAPK8)
   04530 Tight junction
    103084630 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103084630 (MAPK8)
   04621 NOD-like receptor signaling pathway
    103084630 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    103084630 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    103084630 (MAPK8)
   04660 T cell receptor signaling pathway
    103084630 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    103084630 (MAPK8)
   04659 Th17 cell differentiation
    103084630 (MAPK8)
   04657 IL-17 signaling pathway
    103084630 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    103084630 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103084630 (MAPK8)
   04920 Adipocytokine signaling pathway
    103084630 (MAPK8)
   04912 GnRH signaling pathway
    103084630 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    103084630 (MAPK8)
   04917 Prolactin signaling pathway
    103084630 (MAPK8)
   04926 Relaxin signaling pathway
    103084630 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    103084630 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    103084630 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    103084630 (MAPK8)
   04722 Neurotrophin signaling pathway
    103084630 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103084630 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103084630 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103084630 (MAPK8)
   05231 Choline metabolism in cancer
    103084630 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103084630 (MAPK8)
   05212 Pancreatic cancer
    103084630 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103084630 (MAPK8)
   05012 Parkinson disease
    103084630 (MAPK8)
   05016 Huntington disease
    103084630 (MAPK8)
   05017 Spinocerebellar ataxia
    103084630 (MAPK8)
   05020 Prion disease
    103084630 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    103084630 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103084630 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103084630 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    103084630 (MAPK8)
   04931 Insulin resistance
    103084630 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103084630 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103084630 (MAPK8)
   05135 Yersinia infection
    103084630 (MAPK8)
   05133 Pertussis
    103084630 (MAPK8)
   05152 Tuberculosis
    103084630 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103084630 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    103084630 (MAPK8)
   05161 Hepatitis B
    103084630 (MAPK8)
   05171 Coronavirus disease - COVID-19
    103084630 (MAPK8)
   05162 Measles
    103084630 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103084630 (MAPK8)
   05169 Epstein-Barr virus infection
    103084630 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103084630 (MAPK8)
   05142 Chagas disease
    103084630 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103084630 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103084630 (MAPK8)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103084630 (MAPK8)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103084630 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 103084630
NCBI-ProteinID: XP_007446288
UniProt: A0A340WA22
LinkDB
Position
Un
AA seq 427 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattc
acagtcctgaaacggtatcagaatttaaaacctataggttcaggagcccaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcaaactcatgctaagcgtgcttacagagagctagttcttatgaaatgtgta
aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgtcaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaaa
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tcagactgcactttgaagattcttgactttggactggccaggactgcaggaactagtttt
atgatgacaccttatgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtacttttc
ccagctgactcggaacacaataaacttaaagccagtcaggcaagggatttgttatctaaa
atgctggtaattgatgcatctaaaaggatttctgtagatgaagctctccagcacccgtat
atcaacgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatacaaagaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcaaccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcatcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctcggatacagacagcagtctagaagcatcagct
ggacctctgggctgctgtagatga

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103087676
Entry
103087676         CDS       T03090                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04024  cAMP signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04137  Mitophagy - animal
lve04140  Autophagy - animal
lve04141  Protein processing in endoplasmic reticulum
lve04210  Apoptosis
lve04215  Apoptosis - multiple species
lve04217  Necroptosis
lve04310  Wnt signaling pathway
lve04380  Osteoclast differentiation
lve04510  Focal adhesion
lve04530  Tight junction
lve04620  Toll-like receptor signaling pathway
lve04621  NOD-like receptor signaling pathway
lve04622  RIG-I-like receptor signaling pathway
lve04625  C-type lectin receptor signaling pathway
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04722  Neurotrophin signaling pathway
lve04723  Retrograde endocannabinoid signaling
lve04728  Dopaminergic synapse
lve04750  Inflammatory mediator regulation of TRP channels
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04917  Prolactin signaling pathway
lve04920  Adipocytokine signaling pathway
lve04926  Relaxin signaling pathway
lve04930  Type II diabetes mellitus
lve04931  Insulin resistance
lve04932  Non-alcoholic fatty liver disease
lve04933  AGE-RAGE signaling pathway in diabetic complications
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
lve05017  Spinocerebellar ataxia
lve05020  Prion disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05133  Pertussis
lve05135  Yersinia infection
lve05142  Chagas disease
lve05145  Toxoplasmosis
lve05152  Tuberculosis
lve05161  Hepatitis B
lve05162  Measles
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05171  Coronavirus disease - COVID-19
lve05200  Pathways in cancer
lve05210  Colorectal cancer
lve05212  Pancreatic cancer
lve05231  Choline metabolism in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103087676 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103087676 (MAPK9)
   04012 ErbB signaling pathway
    103087676 (MAPK9)
   04014 Ras signaling pathway
    103087676 (MAPK9)
   04310 Wnt signaling pathway
    103087676 (MAPK9)
   04668 TNF signaling pathway
    103087676 (MAPK9)
   04068 FoxO signaling pathway
    103087676 (MAPK9)
   04071 Sphingolipid signaling pathway
    103087676 (MAPK9)
   04024 cAMP signaling pathway
    103087676 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103087676 (MAPK9)
   04137 Mitophagy - animal
    103087676 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    103087676 (MAPK9)
   04215 Apoptosis - multiple species
    103087676 (MAPK9)
   04217 Necroptosis
    103087676 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103087676 (MAPK9)
   04530 Tight junction
    103087676 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103087676 (MAPK9)
   04621 NOD-like receptor signaling pathway
    103087676 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    103087676 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    103087676 (MAPK9)
   04660 T cell receptor signaling pathway
    103087676 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    103087676 (MAPK9)
   04659 Th17 cell differentiation
    103087676 (MAPK9)
   04657 IL-17 signaling pathway
    103087676 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    103087676 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103087676 (MAPK9)
   04920 Adipocytokine signaling pathway
    103087676 (MAPK9)
   04912 GnRH signaling pathway
    103087676 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    103087676 (MAPK9)
   04917 Prolactin signaling pathway
    103087676 (MAPK9)
   04926 Relaxin signaling pathway
    103087676 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    103087676 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    103087676 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    103087676 (MAPK9)
   04722 Neurotrophin signaling pathway
    103087676 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103087676 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103087676 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103087676 (MAPK9)
   05231 Choline metabolism in cancer
    103087676 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103087676 (MAPK9)
   05212 Pancreatic cancer
    103087676 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103087676 (MAPK9)
   05012 Parkinson disease
    103087676 (MAPK9)
   05016 Huntington disease
    103087676 (MAPK9)
   05017 Spinocerebellar ataxia
    103087676 (MAPK9)
   05020 Prion disease
    103087676 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    103087676 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103087676 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103087676 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    103087676 (MAPK9)
   04931 Insulin resistance
    103087676 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103087676 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103087676 (MAPK9)
   05135 Yersinia infection
    103087676 (MAPK9)
   05133 Pertussis
    103087676 (MAPK9)
   05152 Tuberculosis
    103087676 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103087676 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    103087676 (MAPK9)
   05161 Hepatitis B
    103087676 (MAPK9)
   05171 Coronavirus disease - COVID-19
    103087676 (MAPK9)
   05162 Measles
    103087676 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103087676 (MAPK9)
   05169 Epstein-Barr virus infection
    103087676 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103087676 (MAPK9)
   05142 Chagas disease
    103087676 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103087676 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103087676 (MAPK9)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103087676 (MAPK9)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103087676 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 103087676
NCBI-ProteinID: XP_007465571
UniProt: A0A340XW31
LinkDB
Position
Un
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSSDFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgatagtcagttttacagtgtacaagtggcagactcaactttc
actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaattgtc
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcagactcatgcaaagagagcttatcgtgaacttgtcctcttaaaatgtgtc
aatcataaaaatataattagcttgttaaatgtgtttacaccacagaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcat
atggagttggaccatgaaagaatgtcctaccttctttaccagatgctctgtggtattaaa
catctacattcagctggtataattcatagagatttgaaacctagcaacattgtagtaaag
tcagactgtacccttaagatccttgactttggcctggctcgcacagcatgcaccaacttt
atgatgaccccctacgtggtaacgcggtattatcgggcacctgaagtcatcctgggcatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgatcatattgatcagtggaataaagttattgagcag
ctaggaacaccatcttcagatttcatgaagaaacttcagccaactgtgaggaattatgta
gaaaacagaccaaagtatcctggaatcaaatttgaagaactctttccagattggatattc
ccatcagaatctgaacgagacaaaattaaaacaagtcaagccagagacttactatcaaaa
atgttagtgatagatcccgacaagcgaatctctgtagatgaagctttgcgtcacccttat
atcactgtttggtatgaccctgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagta
atggattgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcgtcatctatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtctggatgcctcaacaggacccctt
gaaggttgtcgatga

DBGET integrated database retrieval system