KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078949Help
Entry
103078949         CDS       T03090                                 

Gene name
C8G
Definition
(RefSeq) complement C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04610  Complement and coagulation cascades
lve05020  Prion diseases
lve05146  Amoebiasis
lve05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:lve00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    103078949 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    103078949 (C8G)
  09164 Neurodegenerative disease
   05020 Prion diseases
    103078949 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103078949 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin ASTN_2_hairpin
Motif
Other DBs
NCBI-GeneID: 103078949
NCBI-ProteinID: XP_007459071
UniProt: A0A340XCB3
LinkDB All DBs
Position
Un
AA seq 320 aa AA seqDB search
MLPPRTASLLTLLLAVGSLGQRAQRPPRPPSPISAIQPKANFDAQRFSGTWFLVAVASVC
RSLQEQGHQAEATTLHVTPQGAAMAVSTFRKLDGICWQVQQLYGDTGLPGRFLLQARGAR
GAVDVVVGETDYRGFAILYLERARRLSVKLYTRSLPVSESFLSVFEQRVQGANLTEDHTL
FFPKYGFCEAADQFHILDGEWAAPVGRCGRGLAARSSLLVGSRLCCRSEEVRPAAALHQQ
AAKALKDAYPASSLTPHPPLLGESHGQRRGSLPREPGESFRANGSPRLGPDWGWRVRELV
IGLGKAGPGKRAQVALFGEP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccccaggacggcatccctcctgactctgctcctggccgtcggctccttgggt
cagagggctcagagaccccctcggcccccgtcccccatcagcgccatccagcccaaggcc
aacttcgacgcgcagcggttttcagggacctggttccttgtggctgtggcctctgtgtgc
cgctccctgcaggagcagggccatcaggctgaggccaccacactgcatgtgactcctcag
ggtgcagccatggctgtcagcaccttcaggaagctggatgggatctgctggcaggtgcag
cagctctacggtgacacggggctcccaggtcgctttctgctccaagcccgaggcgcccga
ggggcggtggacgtggtcgttggggagacggactaccggggcttcgccatcctgtacctg
gagcgggcgcggcggctgtcggtgaagctgtacacccgctcgctccccgtgagcgaatca
ttcctgagtgtgtttgagcagcgggttcagggtgccaacctgaccgaggaccacaccctg
ttcttccccaagtatggtttctgcgaggccgcggaccagtttcacatcctggatggtgag
tgggcagcgccggtggggcggtgtggcagggggctggcagcgcgcagctccctcctggtt
gggtctcgtctgtgctgcagaagtgaggaggtgaggccggcggcagccctgcaccaacaa
gcagccaaggccctgaaggacgcctaccccgcttcctccctcaccccgcacccgcccctg
ctgggcgagagccacggccagagaaggggcagcctccctcgagaacctggggaaagtttc
agggcaaatggcagcccccggcttgggccggactggggctggagggtcagggagctggtc
atcggcttgggcaaagccgggcctgggaaaagggcccaagtcgccctgtttggggagcct
tag

DBGET integrated database retrieval system