KEGG   Lipotes vexillifer (Yangtze River dolphin): 103078950Help
Entry
103078950         CDS       T03090                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00020  Citrate cycle (TCA cycle)
lve00190  Oxidative phosphorylation
lve01100  Metabolic pathways
lve01200  Carbon metabolism
lve04714  Thermogenesis
lve04932  Non-alcoholic fatty liver disease (NAFLD)
lve05010  Alzheimer disease
lve05012  Parkinson disease
lve05016  Huntington disease
Module
lve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lve_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103078950 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103078950 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103078950 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103078950 (SDHB)
   05012 Parkinson disease
    103078950 (SDHB)
   05016 Huntington disease
    103078950 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103078950 (SDHB)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103078950 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 103078950
NCBI-ProteinID: XP_007459323
UniProt: A0A340XCW8
LinkDB All DBs
Position
Un
AA seq 280 aa AA seqDB search
MAAVVAVSLRRRFLATTLGRACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDIN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESREGREQYPQSTEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTNSCPKGLNPGKAIAEIKKMMATYKEKKTSP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcagtctccttgaggcgccggttcctggccacaacccttggcaga
gcctgcctgcaggcctgccgtggggcccagacagctgcagccacagctccccgaatcaag
aaatttgccatctatcgatgggacccagacaagactggagataaacctcatatgcaaact
tacgaaattgatttgaataactgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgattctaccttgaccttccgaagatcgtgcagagaaggcatctgcggctcc
tgtgcgatgaacatcaatggaggcaacactctcgcttgtacccgaaggattgacatcaac
ctcaacaaagtttcaaaaatctaccctcttccacatatgtatgtgataaaggatcttgtt
cctgatctgagcaacttctatgcccagtacaagtccattgagccttatttaaagaagaag
gatgaatcccgggaaggcagggagcagtacccgcagtccacagaagatcgtgagaaactg
gacgggctctatgagtgcattctctgcgcctgctgcagcaccagctgcccgagctactgg
tggaatggagacaagtacttgggacccgcggttcttatgcaggcctatcgctggatgatc
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacgaattcctgtcccaaggggctgaatccaggg
aaagctattgctgaaatcaagaaaatgatggcaacttataaggaaaagaaaacttcacct
taa

DBGET integrated database retrieval system