KEGG   Lipotes vexillifer (Yangtze River dolphin): 103079661Help
Entry
103079661         CDS       T03090                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04371  Apelin signaling pathway
lve05034  Alcoholism
lve05165  Human papillomavirus infection
lve05169  Epstein-Barr virus infection
lve05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103079661 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    103079661 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    103079661 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    103079661 (HDAC4)
   05165 Human papillomavirus infection
    103079661 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lve03036]
    103079661 (HDAC4)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103079661 (HDAC4)
Chromosome and associated proteins [BR:lve03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103079661 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 103079661
NCBI-ProteinID: XP_007470003
LinkDB All DBs
Position
Un
AA seq 1148 aa AA seqDB search
MLLSLIYASARPSGMAAAXLGRVLRDTGGLAWASLGLRASEXGRHLPRKAVSSSLELSVA
ISRDRGRLLGTIDGLSGRDQPVELLNPARVNHMPGSVDVASALPLPVAPPAVPMDLRLDH
QFPLPATEPGIREQQLQQELLALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQ
QELLAVKHQQELLEHQRKLERHRQEQELVKQQREQKLQQLKHKEKGKESAVASTEVKMKL
QEFVLNKKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASVSYSHPVLGMYDA
KDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSA
PGSAPSSPNNSSGNASAENGIAPAVPSIPTETSLAHRLVTREGSVGPLPLYTSPSLPNIT
LGLPATGPSAGAASQQDAERLALPALQQRISLFPGTHLTPYLGTAPLERDSGATPSSLLQ
HVVLLEQPPAQTPLVTDRYLAGLGALPLHAQPLVGAERVSPSVHKLRQHRPLGRTQSAPL
PQSAQALQHLVVQQQHQQFLEKHKQHLQQPQLHLSKIIPKASEPARQPESHPEETEEELR
EHQALLEEPFLDRPSGPKEAHALAGVQVKQEPVESDEDDVAPGQRQPTEQELLFRQQALL
LEQQRVHQLRSYQASMEAAGIPVSFGSHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGL
VYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHS
EAHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVG
CVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVTRTLV
VDWDVHHGNGTQQAFYSDPGVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTG
GLDPPMGDAEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYL
TKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRS
MEKVIGIHSQYWRSLQRLASTTSYSLVEAQKCENEEAETVTAMASLSVGVKAPEKRPDEE
PMEEEPPL
NT seq 3447 nt NT seq  +upstreamnt  +downstreamnt
atgcttctgagcctcatttatgcatcagctcgcccaagtgggatggctgctgctnngctg
ggccgtgtgctcagggacactggcgggctggcgtgggcgtccttggggctccgcgcatca
gagnccgggagacatttgcccaggaaggccgttagttcatcgctggagttaagcgtggcg
atctccagagacaggggcaggctgctaggaaccattgatggactttctggccgagaccag
ccggtggagctgctcaaccctgcccgcgtgaaccacatgcccggctcggtggatgtggcc
tcggcgctgcctttgccagtggcccccccggcggtgcccatggacctgcgcctggaccac
cagtttccgctgcccgcgacagagcccggcatccgggagcagcagctgcagcaggagctc
ctggccctcaagcagaagcagcagctccagaggcagatcctcatcgccgagttccagagg
cagcacgagcagctgtcccggcagcatgaagcccagctccacgagcacatcaaacaacag
caggagctgctggccgtgaagcaccagcaggagctgctcgagcatcagcggaagctggag
agacaccgccaagaacaggagctggtgaagcagcagcgggagcagaagctgcagcagctc
aagcacaaggagaaaggcaaagagagtgctgtggccagcacagaagtgaagatgaagcta
caggagtttgtcctcaataaaaagaaggcgctggcccaccggaacctgaaccactgcatg
tccagtgaccctcgctactggtatgggaagacgcagcacagctccctggaccagagctcc
ccgccccagagcggggcgtcggtctcctacagccacccggtcctgggcatgtacgacgcc
aaagatgactttcctctcagaaagacagcatctgaacccaatctgaaattacgctccagg
ctaaagcagaaagtggctgaaagacggagcagccccctgttacgcaggaaagatgggcca
gtggtcacggctctaaaaaagcgtcctttggatgtcacagactcggcctgcagcagcgcc
ccgggctccgcacccagctcacccaacaacagctctgggaatgccagcgcggagaatggg
atcgcgcccgctgtccccagcatcccgaccgagaccagcctggcacacagactcgtgacg
cgagaaggctcggtgggcccgctgcccctgtacacgtcaccatccctgcccaacatcacg
ctgggacttcccgccaccggcccctccgcgggggcggccagccagcaggatgccgagaga
ctggccctcccggccctccagcaacgcatctccctcttccccggcacccacctcaccccc
tacctgggcaccgcacccctggagcgcgactcgggggcgactcccagctcccttctgcag
cacgtggtcctcctggagcagccgcccgcgcagacgcccctcgtcacagaccgctatctt
gcaggcctgggagcgctgcccctgcacgcgcagcccctggtgggggcggagcgcgtgtcc
ccgtccgtgcacaagctgcgacagcaccgcccgctgggccgcacgcagtcggcgccgctg
ccccagagcgcgcaggcgctgcagcacctggtggtccagcagcagcaccagcagttcctg
gagaagcacaagcagcacttgcagcagccgcagctgcacctcagcaagatcatccccaaa
gcgagcgagccggcccggcagcccgagagccatcccgaggagaccgaggaggagctgcgc
gagcaccaggccctcctggaggagcccttcctggaccggccctcggggccgaaggaggcg
cacgcgctggccggggtgcaggtgaagcaggagcccgttgagagcgatgaggacgacgtg
gcgccgggccagcggcagcccaccgagcaggagctgctgttcagacagcaagccctcctc
ctggagcagcaacgggtccaccagctgaggagctaccaggcgtcgatggaggcggccggc
atccccgtgtcctttggcagccaccggcctctgtcccgggcgcagtcctcccccgcgtcc
gccaccttccccatgtctgtgcaggagcccccgaccaagccgcggttcaccacaggcctc
gtgtatgacacgctgatgctgaagcaccagtgcacctgtgggaacaccaacagccacccg
gagcacgccgggcgcatccagagcatctggtcccggctgcaggagaccggccttcgaggc
aaatgtgagtgcatccgcggacgcaaggccaccctggaggagctgcagacggtgcactcg
gaggcgcataccctgctctacggcacaaaccccctcaacaggcagaaactggacagtaag
aaacttctaggctcgctaacgtcggtgtttgtcaggctgccctgcggtggtgtcggggta
gacagtgacaccatatggaacgaggtccactcgtcgggggcagcccgcctggccgtgggc
tgcgtggtggagctggtcttcaaggtggccacaggggaactgaagaatggctttgccgtg
gtccgccccccgggacaccacgcagaggagagcacgcccatgggcttctgttacttcaat
tccgtggctgtcgcagccaagcttctccagcagaggttgagtgtgaccaggaccctcgtg
gtggactgggacgtgcaccacgggaacgggacccagcaggccttctacagtgaccccggc
gtgctgtacgtctcgctgcaccgctacgacgacgggaatttcttcccgggcagcggggca
cccgacgaggtgggcacggggcccggcgtgggcttcaacgtcaacatggctttcaccggc
ggcctcgacccccccatgggagacgcagagtacttggcggccttcagaactgtggtcatg
ccgatcgccaacgagtttgccccagacgtggtgctggtgtcatcgggcttcgacgccgtg
gagggccaccccacgcccctcggaggctataacctctccgccaaatgtttcgggtacctg
acgaagcagctgatgggcttggctggcggccggatcgttctggcgctggaggggggccat
gacctcacagccatttgcgacgcctcggaagcctgcgtctctgctttgctgggaaacgag
cttgatcctctcccagaaaaggttttacagcagagacccaacgcgaacgctgtccggtcg
atggagaaggtcattgggatccacagccagtactggcgctccctgcagaggctcgcctcc
accaccagctactctctggttgaggcccagaagtgcgagaacgaagaggccgagaccgtc
actgccatggcctcgctgtccgtgggcgtgaaggcccctgagaagaggcccgacgaggag
cccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system