KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080643
Entry
103080643         CDS       T03090                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04072  Phospholipase D signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04640  Hematopoietic cell lineage
lve04916  Melanogenesis
lve05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103080643 (KITLG)
   04014 Ras signaling pathway
    103080643 (KITLG)
   04015 Rap1 signaling pathway
    103080643 (KITLG)
   04072 Phospholipase D signaling pathway
    103080643 (KITLG)
   04151 PI3K-Akt signaling pathway
    103080643 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103080643 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    103080643 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103080643 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103080643 (KITLG)
Cytokines and growth factors [BR:lve04052]
 Growth factors
  Growth factors (RTK binding)
   103080643 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103080643
NCBI-ProteinID: XP_007449179
UniProt: A0A340WQ37
LinkDB
Position
Un
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNKSIDAFKDLKMVASKTSECVMSSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIEDSNLQWAAVALPAFFSLIIGFAVGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctgaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacctaggctgtttactcctgaaaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttgaagatggtggcttctaaa
actagtgaatgtgtgatgtcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatcccattgaagactccaacctacaatgggcagccgtagca
ttgccagcattcttttctcttataattgggtttgctgttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system