KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080733
Entry
103080733         CDS       T03090                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01522  Endocrine resistance
lve01524  Platinum drug resistance
lve04012  ErbB signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04110  Cell cycle
lve04115  p53 signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04218  Cellular senescence
lve04630  JAK-STAT signaling pathway
lve04921  Oxytocin signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05200  Pathways in cancer
lve05202  Transcriptional misregulation in cancer
lve05203  Viral carcinogenesis
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05217  Basal cell carcinoma
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05222  Small cell lung cancer
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103080733 (CDKN1A)
   04630 JAK-STAT signaling pathway
    103080733 (CDKN1A)
   04066 HIF-1 signaling pathway
    103080733 (CDKN1A)
   04068 FoxO signaling pathway
    103080733 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    103080733 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103080733 (CDKN1A)
   04115 p53 signaling pathway
    103080733 (CDKN1A)
   04218 Cellular senescence
    103080733 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103080733 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    103080733 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103080733 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    103080733 (CDKN1A)
   05206 MicroRNAs in cancer
    103080733 (CDKN1A)
   05205 Proteoglycans in cancer
    103080733 (CDKN1A)
   05203 Viral carcinogenesis
    103080733 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103080733 (CDKN1A)
   05212 Pancreatic cancer
    103080733 (CDKN1A)
   05225 Hepatocellular carcinoma
    103080733 (CDKN1A)
   05226 Gastric cancer
    103080733 (CDKN1A)
   05214 Glioma
    103080733 (CDKN1A)
   05216 Thyroid cancer
    103080733 (CDKN1A)
   05220 Chronic myeloid leukemia
    103080733 (CDKN1A)
   05217 Basal cell carcinoma
    103080733 (CDKN1A)
   05218 Melanoma
    103080733 (CDKN1A)
   05211 Renal cell carcinoma
    103080733 (CDKN1A)
   05219 Bladder cancer
    103080733 (CDKN1A)
   05215 Prostate cancer
    103080733 (CDKN1A)
   05213 Endometrial cancer
    103080733 (CDKN1A)
   05224 Breast cancer
    103080733 (CDKN1A)
   05222 Small cell lung cancer
    103080733 (CDKN1A)
   05223 Non-small cell lung cancer
    103080733 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103080733 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103080733 (CDKN1A)
   05161 Hepatitis B
    103080733 (CDKN1A)
   05160 Hepatitis C
    103080733 (CDKN1A)
   05163 Human cytomegalovirus infection
    103080733 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103080733 (CDKN1A)
   05169 Epstein-Barr virus infection
    103080733 (CDKN1A)
   05165 Human papillomavirus infection
    103080733 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103080733 (CDKN1A)
   01522 Endocrine resistance
    103080733 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103080733
NCBI-ProteinID: XP_007467335
UniProt: A0A340Y751
LinkDB
Position
Un
AA seq 164 aa
MSEPSRDAHQIPRSSRACRRLFGPVDSEQLRRDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGFGLPKIYLPAGPRGTRDDLGGGKWPSTSSALLQGTSQEDHVDLSLSCTLV
PRSPERLEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLISSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatccagggatgcccatcagatcccacgcagcagcagggcatgccgccgc
ctctttggcccggtggacagtgagcagctgcgccgggactgcgatgccctgatggccagc
tgcgtgcaggaggcccgagagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgcgtgaggggctttggcctgcccaagatctacctgcctgca
gggccccgggggacccgggacgacctgggagggggcaagtggccgagcacctcatctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcactgtcctgcaccctcgtg
cctcgctcccctgagcggcttgaggggtccccgggagggccgggcacctcccagggacga
aaacggcgacagaccagcatgacagatttctatcactctaaacgccggctgatcagctcc
aagaggaagccctaa

DBGET integrated database retrieval system