KEGG   Lipotes vexillifer (Yangtze River dolphin): 103080813
Entry
103080813         CDS       T03090                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04540  Gap junction
lve04657  IL-17 signaling pathway
lve04722  Neurotrophin signaling pathway
lve04912  GnRH signaling pathway
lve04921  Oxytocin signaling pathway
lve05206  MicroRNAs in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103080813 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103080813 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    103080813 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103080813 (MAPK7)
   04921 Oxytocin signaling pathway
    103080813 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103080813 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103080813 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103080813 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103080813 (MAPK7)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103080813 (MAPK7)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103080813 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 103080813
NCBI-ProteinID: XP_007448474
UniProt: A0A340WN15
LinkDB
Position
Un
AA seq 774 aa
MAEPLKEDDGEDGSGEPPGPGKAEPTGPAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPLPCPGPAPDTVDLTLQPPPPASEPAPPKREGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSADPLAGLVLSDNDRSLLERWTRMARPPAPAPTPPPARPRSPPAAPPPQ
PTCPPAGPAAAPPQTTTSSGLLAPQPLGPPPGLPGASAPSVLPYFPSGPPPPDPGGAPQP
STSESPDVTLVTQQLSKSQVEDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADG
PQDGQADSASLSASLLADWLEGHGINPADIESLQREIQMDSPMLLADLPDLQEP
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggctgagcccctgaaggaggacgacggcgaggatggctccggagagccccccgggccg
ggaaaggcggaacccaccggccccgccgcctccgtggcggccaagaacctggccctgctg
aaggcgcgctccttcgacgtgaccttcgacgtgggggacgagtacgagatcatcgagacc
atcggcaacggggcctatggggtggtgtcctccgcgcgccgccgcctcaccggccagcag
gtggccattaagaagatccctaacgcttttgacgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaaacacttcaagcacgacaacatcattgccatcaaggacatc
ctgaggcccactgtgccctatggcgagttcaaatctgtctatgtggtcctggacctgatg
gagagtgacctgcaccagatcatccactcctcgcagccgctgacgctggagcacgtgcgc
tacttcctgtaccagctgctgcggggcctcaagtacatgcactcggctcaggtcatccac
cgcgacctcaagccctccaacctgctggtgaacgagaactgcgagctcaagattggggac
ttcggcatggcccgaggcttgtgcacctcgcccgccgagcatcagtacttcatgaccgag
tacgtggccacgcgctggtaccgagcccccgaactcatgctctccctgcacgagtacacg
caggctatcgacctgtggtctgtgggctgcatctttggggagatgctggcccgccgccag
ctcttcccaggcaaaaactacgtgcaccagctgcagctgatcatgatggtgctgggtacc
ccgtcgcctgccgtgattcaggccgttggggctgagagggtgcgggcctacatccagagc
ctgccgccgcgccagcctgtgccctgggagacggtgtacccgggtgccgaccgccaggcc
ctctccctgctggggcgcatgctgcgttttgagcccagtgcccgcatctcagcagctgcc
gcccttcgccaccccttcctggccaagtaccacgaccccgatgacgagcctgactgcgcc
ccgccctttgactttgcctttgaccgcgaagccctcacacgggaacgcattaaggaggct
atcgtggccgagatcgaagacttccacgcacggcgcgagggcatccgccagcagatccgc
ttccagccttccctacagcctgtggccagtgagcccggctgccccgatgttgagatgccc
agtccctgggctcccagtggggactgtgccatggagtcccctccaccggccccactgcca
tgccccggccctgcgcccgacaccgtcgatctgaccctgcagccgcccccgccggccagt
gaaccagcccctccaaagagggagggagccatctcagacaacaccaaggctgccctcaag
gccgccctgctcaagtccttgcggagtcggctccgagatggccccagcgcccccctggaa
gctcccgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggcgacggcaggagcgggccaaggagcgggagaagcggcggcaggagcgggagcgc
aaggagcggggcgccggggcctccgggggcccctccgccgaccccctggccgggctggtg
ctcagcgacaacgaccgcagcctgctggagcgctggactcgcatggcccggccccccgcc
cccgcgcccacgccgccccccgcccggccccgcagcccgcctgcggcccccccgccacag
cctacctgcccgcccgctgggcctgcggctgctccaccccagaccaccacctcctccggc
ctcctggccccccagccgctggggcccccccctgggctacctggcgccagcgccccgagc
gttctgccttacttcccctctggcccacctcctccagaccccgggggcgcccctcagccc
tccacctccgaatcacccgacgtcaccctggtgacccagcagctatccaagtcgcaggtg
gaggaccccttgccccccgtgttctccggcaccccaaagggcagtggagcgggctatggc
gttggctttgacctggaggaattcctaaaccagtctttcgacatgggcgtggctgacgga
ccacaggatggccaggccgactcagcctcgctctcagcctccctgctcgccgactggctc
gagggccacggcataaaccctgctgacatcgagtccctgcagcgtgagatccagatggac
tcccccatgctgctggctgacctgcctgacctccaggagccctga

DBGET integrated database retrieval system