KEGG   Lipotes vexillifer (Yangtze River dolphin): 103081188
Entry
103081188         CDS       T03090                                 

Gene name
MMP14
Definition
(RefSeq) matrix metallopeptidase 14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04668  TNF signaling pathway
lve04912  GnRH signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103081188 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103081188 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    103081188 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lve01002]
    103081188 (MMP14)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     103081188 (MMP14)
Peptidases and inhibitors [BR:lve01002]
 Metallo peptidases
  Family M10
   103081188 (MMP14)
SSDB
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 DUF4953 Metallopep HTH_17 Reprolysin_3 Peptidase_M66 SKG6
Other DBs
NCBI-GeneID: 103081188
NCBI-ProteinID: XP_007449585
UniProt: A0A340WRK3
LinkDB
Position
Un
AA seq 582 aa
MSLAPRPARSLLLPLLALASALASLSSAQSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSL
SAAIAAMQRFYGLRVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQH
NEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLHFREVPYAYIREGHEKQADIMIFF
AEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHEL
GHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSESGSPTKMPPQPRTTS
RPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRKNQVMDGYPMPIGQFW
RGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFW
MPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGN
KYWKFNNQKLKVEPGYPKSALRDWMGCPSSGGRPDEGTEEKTEVIIIEVDEEGSGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgtctctcgccccacgacccgcccgcagtctgctgctccccctgctcgcgctcgcctcc
gcgctcgcctccctcagctctgcccaaagcagcttcagccccgaagcctggctgcagcag
tatggctacctgccccctggggacctgcgtacccacacacagcgctcgcctcagtcactc
tcagctgccatcgctgccatgcagaggttctacggtctgcgagtgacaggcaaggctgat
gcagacaccatgaaggccatgaggcgcccccgctgtggtgttccagacaagtttggggct
gagatcaaggccaatgttcgaaggaagcgctatgccatccagggcctcaaatggcagcat
aacgagatcactttctgcatccagaactacacccccaaggtgggggagtatgccacattc
gaggccatccgcaaggcgttccgtgtgtgggagagtgccacgccgctgcacttccgagag
gtaccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttcttt
gctgagggtttccacggtgacagcacgcctttcgatggcgagggcggtttcctggcccat
gcctacttcccaggccccaacattggaggggacacccactttgactctgccgagccctgg
actgtccagaatgaggatctgaatgggaatgacatctttctggtggctgtgcacgagctg
ggccatgccctgggccttgagcattccaatgatccctcggccatcatggcacccttttac
cagtggatggacacagagaacttcgtgctgcccgatgatgaccgccggggcatccagcaa
ctttatgggagcgagtcagggtcccccaccaagatgccccctcaacccaggaccacctcc
aggccctctgtccctgataagcccaaaaatcccacctatgggcccaacatctgtgatggg
aactttgacaccgtggccatgctccgaggggagatgtttgtcttcaaggagcgctggttc
tggcgggtgaggaaaaaccaggtgatggatggataccccatgcccatcggccagttctgg
cggggcctgcctgcatccatcaacactgcctatgagaggaaggatggcaagtttgtcttc
ttcaaaggagacaagcactgggtgtttgacgaagcttccctggagcctggctaccccaag
cacattaaggaactgggtcgaggactgcctaccgacaagatcgatgctgctctcttctgg
atgcccaacggaaagacctatttctttcggggaaacaagtactaccgtttcaacgaggag
ctcagggcggtggacagcgagtaccccaaaaacatcaaggtctgggaaggaatccctgag
tctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaaggggaac
aaatactggaaattcaacaaccagaagctgaaggtcgagccgggctaccccaagtcagcc
ctgcgggactggatgggctgcccgtcgtcggggggccggccggatgaggggactgaggag
aagacggaggtgatcatcatcgaggtggacgaggaaggcagcggagcagtgagcgcggcc
gccgtggtgctgcctgtgctgctgctgctcctggtgctggcggtgggcctcgccgtcttc
ttcttccgacgccacgggacccccaagcgactgctctattgccagcgctccctgctggac
aaggtctga

DBGET integrated database retrieval system