KEGG   Lipotes vexillifer (Yangtze River dolphin): 103081641
Entry
103081641         CDS       T03090                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 6-like
  KO
K04433  mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04218  Cellular senescence
lve04380  Osteoclast differentiation
lve04620  Toll-like receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05145  Toxoplasmosis
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
lve05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103081641
   04015 Rap1 signaling pathway
    103081641
   04668 TNF signaling pathway
    103081641
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103081641
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103081641
   04664 Fc epsilon RI signaling pathway
    103081641
  09152 Endocrine system
   04912 GnRH signaling pathway
    103081641
   04935 Growth hormone synthesis, secretion and action
    103081641
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103081641
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103081641
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103081641
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103081641
   05022 Pathways of neurodegeneration - multiple diseases
    103081641
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103081641
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103081641
   05135 Yersinia infection
    103081641
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103081641
   05161 Hepatitis B
    103081641
   05163 Human cytomegalovirus infection
    103081641
   05167 Kaposi sarcoma-associated herpesvirus infection
    103081641
   05169 Epstein-Barr virus infection
    103081641
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103081641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103081641
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103081641
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103081641
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal CLP1_P Choline_kinase DUF4344 APH
Other DBs
NCBI-GeneID: 103081641
NCBI-ProteinID: XP_007449111
UniProt: A0A340WK70
LinkDB
Position
Un
AA seq 394 aa
MLNSQQGEKGRPSWVKRIGSLILTLHPALVKNLIHDLSVHLGSSAQPGDWCLSFTAVLVG
SKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIVELGRGAYG
VVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDV
WICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNV
LINTLGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGI
TMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSEEFADFTSQCLKKNSKERPTY
PELMQHPFFTYTXXXLHESKATDVASFVKSILGD
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgctgaactcccagcagggagaaaagggcaggccttcctgggtaaagaggattggcagc
cttatactgacattgcatcctgcactggtgaaaaacctcatccatgacctcagtgtgcac
ttgggaagctctgctcagcctggtgactggtgcttgtcattcacagccgtcctggtagga
agcaagaagagaaaccctggccttaaaatccccaaagaagcatttgaacaacctcagacc
agttccacgccacctcgagatttggactccaaagcttgcatttctattggaaatcagaac
tttgaggtgaaggcggatgacctggagcctatagtggagctgggccggggggcgtacggg
gtggtggagaagatgcggcatgtgcccagcgggcagatcatggcggtgaagcggatccgg
gccacagtaaatagccaggagcagaaaaggttactgatggatttggatatttccatgagg
accgtggactgtccttttacggtcaccttttatggcgcactcttccgtgagggggatgtc
tggatctgcatggagctcatggacacgtccctagataaattctacaaacaagtgattgat
aaaggccaaacaattccagaggacatcttagggaaaatagcagtttctattgtaaaagca
ttagaacatttacacagtaagctctctgtcattcatcgagatgtcaagccttccaatgtg
ctcatcaacaccctgggccaggtgaagatgtgcgattttggaatcagcggctaccttgtt
gactccgtcgctaaaactatcgatgcaggatgcaaaccgtacatggcccccgagagaata
aatccagagctcaaccagaagggatacagcgtgaagtccgacatttggagtctgggcatc
actatgatcgagctggccatccttcggtttccctatgattcgtggggaactccttttcag
cagctcaaacaggtggtggaggagccgtcgccacaactccccgcagacaagttctccgaa
gagtttgctgattttacctcacagtgcttgaagaagaattccaaagaaaggccaacatat
ccagagcttatgcaacatccatttttcacctacacnnnnnnnnnnctacacgaatccaaa
gcgacagacgtggcatcttttgtaaaatcgattcttggagactaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103091611
Entry
103091611         CDS       T03090                                 

Gene name
MAP2K3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04015  Rap1 signaling pathway
lve04218  Cellular senescence
lve04620  Toll-like receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04668  TNF signaling pathway
lve04714  Thermogenesis
lve04750  Inflammatory mediator regulation of TRP channels
lve04912  GnRH signaling pathway
lve04935  Growth hormone synthesis, secretion and action
lve05014  Amyotrophic lateral sclerosis
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05145  Toxoplasmosis
lve05161  Hepatitis B
lve05169  Epstein-Barr virus infection
lve05170  Human immunodeficiency virus 1 infection
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103091611 (MAP2K3)
   04015 Rap1 signaling pathway
    103091611 (MAP2K3)
   04668 TNF signaling pathway
    103091611 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103091611 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103091611 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    103091611 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103091611 (MAP2K3)
   04935 Growth hormone synthesis, secretion and action
    103091611 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103091611 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103091611 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103091611 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103091611 (MAP2K3)
   05022 Pathways of neurodegeneration - multiple diseases
    103091611 (MAP2K3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103091611 (MAP2K3)
   05135 Yersinia infection
    103091611 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103091611 (MAP2K3)
   05161 Hepatitis B
    103091611 (MAP2K3)
   05169 Epstein-Barr virus infection
    103091611 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103091611 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103091611 (MAP2K3)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103091611 (MAP2K3)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103091611 (MAP2K3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase RIO1
Other DBs
NCBI-GeneID: 103091611
NCBI-ProteinID: XP_007448422
UniProt: A0A340WLC1
LinkDB
Position
Un
AA seq 347 aa
MESPAASQPAGVPASKGKSRRKKGLRISCVSKPPAPSPTPPRNLDSRAFITIGDRNFEVE
ADDLVSISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKDMAIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggagtctcctgccgcgagccagcccgccggtgtgcccgcatccaaagggaagtccagg
aggaagaagggtttacgaatctcctgtgtgtccaagccgccggcgcccagccccacgccc
ccccggaacctggactcccgggccttcatcaccatcggggacaggaactttgaggtggag
gcggacgacctggtgtccatctcagagctgggccgaggcgcctacggggtagtggagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcgcatccgtgccaccgtgaac
tcgcaggagcagaagcgcctgctcatggacttggacgtgaacatgcgcacggtcgactgc
ttctacaccgtcacgttctacggggccctcttcagagagggagacgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggacaaggacatggcg
atcccagaggacattctcggggaaatcgctgtatctattgtgagggccctggagcacctg
cacagcaagctgtccgtgatccacagagacgtgaagccgtccaacgtgctcatcaacaag
gagggccacgtgaagatgtgcgactttgggatcagtggctacctggtggattccgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagagaattaacccggagctg
aaccagaaaggctacaatgtcaagtccgacgtctggagcctcggcatcaccatgatcgag
atggccatcctgcggtttccttatgagtcctgggggaccccattccagcagctgaagcag
gtggtggaggagccgtccccgcagctcccagctgaccgcttctcccccgagtttgtggac
ttcactgcacagtgcctgagaaagaaccctgcggaacgcatgagctacctggagctgatg
gaacaccctttcttcacctcgcacaaaaccaagaagaccgacatcgctgcctttgtgaag
gagatcctgggagaggactcgtag

DBGET integrated database retrieval system