KEGG   Lipotes vexillifer (Yangtze River dolphin): 103081817Help
Entry
103081817         CDS       T03090                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve00052  Galactose metabolism
lve00500  Starch and sucrose metabolism
lve01100  Metabolic pathways
lve04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:lve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103081817 (MGAM)
   00500 Starch and sucrose metabolism
    103081817 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103081817 (MGAM)
Enzymes [BR:lve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103081817 (MGAM)
    3.2.1.20  alpha-glucosidase
     103081817 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 103081817
NCBI-ProteinID: XP_007466695
UniProt: A0A340Y5D1
LinkDB All DBs
Position
Un
AA seq 1828 aa AA seqDB search
MARKKLKKFTTLELMLSVLLLVVFIITIPLFVLSARDSLESEGPGMTVTPDPGKSTTPGS
AECPVVNELERINCIPDQSPTKAMCDQRGCCWKPQGTISVPWCYYSKSHGYQVEGNLVNT
YAGFTAQLKRLPSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQDRYEVPHEHVQPFKG
NAAASLTYKVEVSKQPFSIKVIRTSNNHVLFDSSIGPLLFADQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFARDTIPKGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAM
EVSLQPTPAVTYRTTGGILDFYVFLGNTPEQVVQEYQELIGRPALPSYWALGFHLSHYDY
GTLGNMKEVMERNRAAQLPYDVQHAGIDYMHERKDFTYDPVNFKGFPEFVKELHNNGQKL
VIIVDPAISNNSSPSNPYGPYDRGSDMKIWVNASDGVTPLIGEVWPGKTVFPDYTDPKCT
AWWANECELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRILDGYLFCKS
LCMDAVQHWGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFILTRSTFAGSGKFAAHWLG
DNAATWNDLRWSIAGMLEFSLFGIPMVGSDICGFTLDAPEELCRRWMQLGAFYPFSRNHN
GQGYKAQDPASFGADSLLLNSSRHYLTIRYALLPYLYTLFYRAHSQGDTVARPLLHEFYE
DSNTWDVQQQFLWGPGLLITPVLAEGAEKVTAYVPDAVWYDYETGGRVKWRKQKVEMELP
GDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDDNKEAKGELFWDDGETKDTVAN
KVYLLCEFSVTQNHLDVKILQSTYTDPNNLAFKEIKILGTQEPTNVIVKHSGVKIQVSPN
VTYDSNLQVALITEIDLVLGGIYTVEWDVKIRDAEKIDCYPDENGASAENCTARGCVWEV
SGSPGVPLCYFVNDLYSVSDVQYDLHGATAVLSLKSSYASSLPSVPVNSLRLNVTYHKDN
MLQFKIYDPNNNRYEVPVPLNIPRVPSSTSESRLYDVLIKKNPFGIEIRRKSTGTVIWDS
QLLGFTFNDMFIRISTRLPSQYLYGFGETEHTAFRRDLNWNTWGMFSRDQPPGYKKNSYG
VHPYYMALEEDGNAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVFLGPTPELVTQQ
YTELIGRPVMVPYWSLGFQLCRYGYKNDSEIGSLYDEMVAAQIPYDVQYADIDYMERQLD
FTLSPEFEGLPALITRMKADGMRVILILDPAISGNETKPYPPFTRGVEDDVFIKDPNDGS
IVWGKVWPDFPDIVINSSLDWESQVEQYRAYVAFPDFFRNSTISWWKRELREMYTNPRVP
EKSLKFDGMWIDMNEPASFVSGAVPPGCKDARLNHPPYMPHLESRDRGLSSKTLCMESQQ
LLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNT
AAWDQLRKSIIGMMEFSLFGISFTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNSIG
ARRQDPVSWDSTFVTISRSVLQTRYTLLPYLYTLMHRANTEGSTVVRPLLHEFVSDQVTW
DVDSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGVDIQARGEWKSLPAPLDHIN
LHVRGGYILPWQKPAQNTHLSRQKFTGFKVALDDEGTAEGWLFWDDGQSIDTYGKGLYYL
AHFSVSQNTMHSHVIFNKYISDTNPLKLGYIEIWGVGSVSVSSVSISVSGVDITPTFSYN
STTQVLNIDVTRRNLSLHNFTSLTWRAL
NT seq 5487 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaaaagttcactactttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactattcctctctttgtgctttcagccagagactctttggaa
tcagaaggtcctgggatgacagttactccagatcctgggaaaagtaccactcctggttct
gccgagtgcccagtggtaaatgaattggaacggataaactgcatccctgaccagtcacca
acaaaggccatgtgtgaccagcgtgggtgctgctggaaacctcagggaaccataagtgtg
ccctggtgctactattctaagagtcatggctatcaagtggagggcaaccttgtgaacaca
tatgcaggattcacagcccagttgaaaaggttgccttctccatctctttttggaaatgat
gtcaacaacgtccttctcacagcggaataccagacgtctaaccgtttccactttaagtta
actgaccaaaaccaggacagatatgaagtgccccatgaacatgtgcaacccttcaaagga
aatgctgctgcttccttgacctataaagttgaggtctccaaacagccatttagcatcaaa
gtgatcagaacgagcaacaatcacgttctgtttgactccagcatcgggcccctgctgttt
gctgatcagttcctgcagctctccatccgactgcctagtgctaacgtgtatggtctggga
gaacacgtgcaccagcagtaccggcacgatatgaattggaagacctggcccatatttgcc
agagacacaatccccaaaggggatggaactaacttgtatggtgcacagacattcttccta
tgccttgaagatgctagtggattgtcctttggagtgtttctgatgaacagcaatgccatg
gaggtttccctccagcccaccccagctgtcacttaccgcaccactgggggcattctcgac
ttctacgtgttcttgggaaacactccagagcaagtggttcaagagtatcaagagctcatt
ggacggccagccctaccctcatactgggcacttgggtttcatctcagtcattatgactat
ggaaccctgggtaacatgaaagaagtcatggagagaaaccgtgccgcacagctgccttac
gacgttcagcatgctggtattgattatatgcacgagaggaaggacttcacttatgatcca
gtcaattttaagggcttccctgagtttgttaaagagttacacaataacggacaaaaattg
gtcatcattgtggatccagccatctccaacaactcttccccaagtaatccctatggccca
tatgacaggggttcagatatgaagatatgggtgaatgcttcagatggagtgactccactc
attggggaggtctggcctggaaaaaccgtgtttcctgattacaccgaccccaaatgtact
gcttggtgggcaaatgaatgtgagcttttccacaatcaagtagaatttgatggaatctgg
attgatatgaatgaagtctccaacttcgtggatggttcagtttcaggatgttccacaagc
aatctaaattatcccccattcactcccagaatcctggatgggtacctgttctgcaagagt
ctctgcatggatgcagtacagcactggggaaagcaatacgatgtccacaatctatatggc
tactccatggcaattgccacagcagaagctgtcaagactgtgttccctaacaagagaagc
ttcattttaacccgttctacctttgcggggtctggcaagtttgcagcccactggttagga
gacaacgcagccacctggaatgaccttcgatggtccatcgctggcatgctcgagttcagc
ctttttggtatcccaatggtgggttctgacatatgtggctttacactggatgctcctgaa
gagctctgcaggaggtggatgcagctgggagcattctatccattttccaggaatcacaat
ggccaaggctacaaggcccaggatcctgcctcctttggagctgactctctgctgttgaat
tcctccaggcactaccttaccatccgctatgctctattgccctatctctacaccctcttc
taccgtgctcacagccagggggacacggtggccaggccccttctgcatgagttctacgag
gacagcaacacttgggatgtgcagcaacagtttttatgggggcccggcctcctcatcact
ccggttctggctgagggtgcagagaaagtgacagcatatgtgcctgatgccgtctggtat
gactatgagactgggggccgagtgaaatggaggaagcaaaaagtggagatggaacttcct
ggagacaaaattggacttcaccttcgaggaggctacatcttccccacacagcagccagcc
acaaccactgtggccagtcgaaggaaccctcttggtcttatcattgccctggatgacaac
aaagaagcaaaaggcgaacttttctgggatgatggggaaacgaaagatactgtggccaat
aaagtttacctcttatgtgagttctccgtcacccaaaaccacttggatgtgaagattttg
caatcaacctacacagaccccaataatttagcatttaaagagattaaaatccttgggacc
caggaacctaccaatgttatagtgaaacacagcggtgtcaaaattcaagtttctcctaat
gtcacttatgattctaacctccaggtggcccttatcacagaaattgatcttgtcctggga
ggaatatacacggtggagtgggatgtgaagataagggatgcagaaaaaattgactgttat
cctgatgagaatggtgcttctgcagaaaactgtaccgcccgcggctgtgtctgggaggta
tccggttctcctggagtccctttgtgctattttgtcaatgatctatactctgtcagtgat
gttcagtatgacttacatggggccacagctgtcctctccttaaagtcttcgtatgcctcc
tctttgccctccgtacccgtgaactccctccgtctgaatgtgacctaccataaggataac
atgctgcagtttaagatttatgatcccaacaacaaccggtatgaagttccagtccctctc
aacatacccagggttccatccagcacctctgagagtcgactctatgatgtcctcattaag
aagaatcctttcgggattgaaattcgccggaagagtacaggcactgtaatttgggactct
cagctccttggcttcaccttcaacgacatgttcatccgcatctccacgcgcctcccctcc
cagtacctctatggctttggggaaactgagcacacagcctttcgaagagatttgaactgg
aacacgtggggaatgttttcccgagaccaacccccggggtacaagaagaattcctatggt
gtccacccctactacatggcactggaggaggatggcaatgcccatggggtcctgctgctg
aacagcaacgccatggatgtgacattccagcccttgcctgccttgacataccgtaccaca
ggaggaattctggacttttatgtcttcttggggccaactccagagcttgtcactcagcag
tacactgagttgattggtcggccagtgatggttccttattggtccttggggtttcagctg
tgtcgctatggatacaagaacgactctgagattggtagcttgtatgatgagatggtggct
gcccagatcccctatgacgtgcagtacgcggacatcgactacatggagcggcagctggac
ttcaccctcagccccgagtttgaggggcttccagctctgattactcgaatgaaggccgac
gggatgcgggtcatcctcattctggacccagccatttctggcaacgagacaaagccctat
ccccctttcacgcggggtgtggaggacgatgtcttcatcaaagatccgaatgatggaagc
attgtttggggaaaggtctggcctgattttcctgatattgttatcaacagttctctagac
tgggaaagtcaagtggagcaataccgagcttatgtggccttcccagactttttccgtaat
tcaaccatctcatggtggaaaagggagttgagagaaatgtacaccaatccacgggttcca
gagaagagcttgaagtttgatggcatgtggattgatatgaatgaaccggcaagcttcgtg
agtggggcagtccctccaggctgcaaggatgcccgtctgaaccaccctccctacatgcca
catctggagtccagggacaggggcctgagcagcaagaccctgtgcatggagagccagcag
ctcctgcctgacggctccccggtgcggcactacgacgtgcacagcctgtacgggtgggcc
cagaccagacccacgtacgaagctgtgcaggaggtgacgggacagcgagggatcgtcatc
actcgctccacttttccctcttctggccgctggggaggacactggctgggtgacaacaca
gccgcgtgggaccagctgaggaaatctatcattggcatgatggagtttagcctcttcggc
atatcctttacaggagcagatatttgtggattctttcaagatgctgaatatgaaatgtgt
gctcgctggatgcagctgggggccttttaccccttctcgaggaaccacaacagcattggg
gccaggaggcaagaccctgtgtcctgggattctacctttgtgactatctccagaagtgtc
ctgcagaccagatacaccctgttgccatatctgtacaccctgatgcacagggccaacacg
gagggcagcactgtcgtgcggcctcttctccatgagtttgtgtcagaccaggtgacctgg
gatgtagacagtcagttccttctgggcccagccttcctggtcagccctgtcctggagcct
aatgccagaaatgtcactgcatatttccctagagcccgctggtatgattactacacgggt
gtggacattcaagcccggggagagtggaagtccttgccagcgcctcttgaccacattaat
cttcatgtccgtgggggctacatcctgccctggcaaaagcctgcacagaacacccactta
agccgtcagaaattcacaggcttcaaggttgccttggatgatgaggggactgctgaaggt
tggctcttctgggatgatgggcaaagcattgatacctatgggaaaggactctactacctg
gcccacttttctgtcagccagaatacaatgcacagtcatgtaattttcaacaaatacatc
agcgatacaaaccctttgaaactgggctacattgagatctggggagtgggcagtgtctcc
gtttccagtgtcagcatctctgtgagcggtgtggatataacacccaccttctcctacaac
tccacaacacaggtgttaaacattgatgtgacccgcagaaacctcagcttacataatttc
acttcattgacatggagagcgctctga

DBGET integrated database retrieval system