KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082490Help
Entry
103082490         CDS       T03090                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04010  MAPK signaling pathway
lve04064  NF-kappa B signaling pathway
lve04210  Apoptosis
lve04380  Osteoclast differentiation
lve04625  C-type lectin receptor signaling pathway
lve04660  T cell receptor signaling pathway
lve04668  TNF signaling pathway
lve04672  Intestinal immune network for IgA production
lve05166  Human T-cell leukemia virus 1 infection
lve05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103082490 (MAP3K14)
   04064 NF-kappa B signaling pathway
    103082490 (MAP3K14)
   04668 TNF signaling pathway
    103082490 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103082490 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103082490 (MAP3K14)
   04660 T cell receptor signaling pathway
    103082490 (MAP3K14)
   04672 Intestinal immune network for IgA production
    103082490 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    103082490 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    103082490 (MAP3K14)
   05169 Epstein-Barr virus infection
    103082490 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103082490 (MAP3K14)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     103082490 (MAP3K14)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  Other
   103082490 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 103082490
NCBI-ProteinID: XP_007455205
UniProt: A0A340X846
LinkDB All DBs
Position
Un
AA seq 959 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKEFAKAKEKTQATEMKQSSVHKLEAVEKSPMFCGKWEILND
VITKGTAKEGSEGGPAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHSTEGKMTRVCWKGKRRSKARRKRKKSSKSLAQAGVALARPLPRTPEQESCTVPVQED
ESPLGTPYVRNTPQFSKPLKEPGLGHLWFKKLGEGLRPALPRPELHKLISPLQCLNHVWK
LHHPQDVGPLPQPAHPFPYSRRPHPFPFHPLQPWKPHPLESFLGKLANCVDSQQPLPGPP
LGRLACVDGQKPLPGPHVKPSCPSHGSSDKLSVEEYLVHALQGSVSSGQARSLASLAKTW
LVGGSKPREPSPETEDSEGVLLIEKLKPVDYEYREDIHWATRQPCLGRGSFGEVHRMEDK
QTGFQCAVKKVRVEVFRAEELMACAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQL
IKQRGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSSDGSHAALCDFGHAVC
LQPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDIWSSCCMMLHMLNGCHPWTQYF
RGPLCLKIASEPPPVREIPPSCAPLTAQAIQEGLRKEPVHRASAAELGGKVSLALQHVGG
LRSPWKGEYKEPRHPPLLQAHPPPSQGHPHQTLCAPPVELSPGELSPEAPGPQPAEDAAG
GASKLQPPPPPEPPEQNKSPSLHWGKEESGTWEPLALSSLDPAPAKSSSSPERKATFPEQ
ELQQLEIELFLNSLSQPFSLEEQEQILSCLSVDSLSLSDDSEKNPSKASQSSRDTLSSGV
HSWSSQAEARSSSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIAT
GISSQIPASAFSLVTKDGQPVRYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccccggctccgcggtcgggcagcagaag
gagttcgccaaagccaaggagaagacacaggcaacggagatgaagcagagctccgtccac
aagctcgaggccgtggagaagagccccatgttctgcgggaagtgggagatcctgaacgac
gtgattaccaaaggcacagccaaggaaggctccgagggcgggccggccgccatctccatc
atcgcccaggccgaatgtgagaatagccaagagttcagccccaccttctccgaacggatc
ttcatcgctggctcgaaacagtacagccagtccgagagtcttgatcaaatccccaacaat
gtggcccactcgaccgagggcaaaatgacccgcgtgtgttggaaggggaagcgtcgcagc
aaagcccggaggaaacgcaagaagagctccaagtccctggctcaggcaggagtggccttg
gccagacccctccccagaacccctgagcaggagagctgcacggtcccggtgcaggaggat
gagtctccgctaggcaccccgtatgttagaaacaccccccagttctccaagcctctgaag
gagccaggccttggccatctctggtttaagaaactcggggagggcctgcggccagcgctg
cctcgaccggaactccacaaactgatcagccccctgcagtgcctaaaccacgtgtggaaa
ctccaccacccccaggacgtaggccccctgccccagcctgctcaccccttcccctatagc
agacggccccaccccttcccgttccaccctctccagccctggaaacctcaccccttagag
tccttcttaggcaaactggcaaactgtgtagacagccagcagcccctgcccggccctccc
ctgggcagactggcctgtgtagacggccagaagcccctgcctggcccacatgtgaagccc
agctgcccgtctcatggctcaagtgacaagctgtccgtggaggagtacctcgtgcacgct
ctgcaaggcagcgtgagctccggccaggcccgcagcctggccagcctggccaagacctgg
ttggtggggggctccaagcctcgggagcccagccctgaaaccgaggacagtgagggggtc
ctgcttatcgagaaactcaagccggtggattatgagtaccgagaggacatccattgggcc
acgcgccagccctgcctgggcagaggctccttcggagaggtccacaggatggaggacaag
caaaccggcttccagtgtgccgtcaaaaaggtgcgagttgaagtgtttcgggctgaggag
ttgatggcatgtgcgggattgacctcacccagaatcgtccctttgtatggagctgtgaag
gaaggtccttgggtcaacatcttcatggagcttctagaaggtggctcgctgggccagctc
ataaagcagaggggctgtctgccagaggaccgggctctttattacctgggccaggctctg
gaaggactggaatacctccatacccgaaggattctacatggagatgtgaaagccgacaat
gtgctcctgtccagcgatgggagccacgcagccctctgcgactttggccatgctgtgtgc
cttcaacctgatggcctggggaagtctttgctcacaggggactacatccccggtacagag
acccacatggcgccagaggtggtgatgggcaagccctgtgatgccaaggtggacatctgg
agcagctgttgcatgatgctgcacatgctcaatggctgccacccttggacccagtacttc
cgagggccgctgtgcctcaagattgccagcgagcctccgcctgtgagggagatcccgccc
tcctgtgcccccctcacagcccaggccatccaggaagggctcaggaaagagcctgtccac
cgagcgtctgcagcagagctgggggggaaggtcagcctggcgctgcagcatgtgggaggt
ctgaggagcccttggaagggagaatacaaagaaccaagacatccgccgctactccaagcc
cacccaccgccaagccaagggcaccctcaccagaccctatgtgccccaccagtggagctc
tcgccaggggagctctcaccagaggccccggggccccagccagctgaggacgcagcaggc
ggggcctctaagctccagcctcctccacccccagagcccccagagcagaacaagtctccc
agcctgcactggggcaaagaagagtccgggacgtgggaaccactggctctgtcctccctg
gatccggccccagccaagagctccagctcaccagagcggaaggcaaccttccccgagcaa
gagctgcaacagctggaaatagaattatttctgaacagcctgtcgcagccattttctttg
gaggaacaggagcaaatcctgtcatgcctcagcgtcgacagcctctccctgtcagatgac
agtgagaagaacccgtccaaggcctctcagagctcgcgggacaccctgagttccggcgtg
cactcgtggagcagccaggcggaggcccgcagctccagctggaacatggtgctggcccgg
gggcggcccaccgacacaccgagctatttcaacggtgtgaaagtccaaatacagtctctc
aatggcgaacacctgcacatccgggaattccaccgggtcaaggtgggagacatcgcaacc
ggcatcagcagccagatcccagcctcagccttcagcctggtgaccaaggatgggcagccc
gtgcgctacgacatggaggtgccagactcgggcatcgacctgcagtgcaccctggcccct
gatggcagcttcgcctggagctggagggtcaagcacggccagctggagaacaggccctaa

DBGET integrated database retrieval system