KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082631Help
Entry
103082631         CDS       T03090                                 

Definition
(RefSeq) anionic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04080  Neuroactive ligand-receptor interaction
lve04972  Pancreatic secretion
lve04974  Protein digestion and absorption
lve05164  Influenza A
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103082631
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    103082631
   04974 Protein digestion and absorption
    103082631
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    103082631
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lve01002]
    103082631
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lve04147]
    103082631
Enzymes [BR:lve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103082631
Peptidases [BR:lve01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103082631
Exosome [BR:lve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103082631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 103082631
NCBI-ProteinID: XP_007466698
UniProt: A0A340Y052
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MNPLLIVVFVGAAVAFPMDDDDKIIGGYTCAENSVPYQVSLNSGYHFCGGSLISDQWVVS
AGHCYKSRIQVRLGEHNIDVLEGREQFIDAAKIIRHPNSSSWTLNTDILLIKLSSPAVID
ARVSTLALPSACAPAGTQCLISGWGNTLSSGVNYPKLLQCLDTPLLSQAECEASYPGQIT
DNMVCAGFLEGGNDSCQGDSGGPLACNGELQGIVSWGSGCAQKGKPGVYTKVCNYVDWIQ
QTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactgctgatcgttgtctttgtgggagctgctgttgcttttcccatggacgat
gatgacaagatcatagggggctacacctgcgcggagaattctgtcccctaccaggtgtcc
ctgaactctggctaccacttctgcgggggctccctcatcagtgaccagtgggtggtgtcc
gcgggtcactgctacaaatcccgcatccaggtgaggctgggagagcacaacatcgacgtc
ctggagggccgtgagcagttcatcgacgcggccaagatcatccgccaccccaactccagc
agctggactctgaacactgacatcttgctgatcaaactctcctcgcctgcggtcattgat
gcccgggtgtccaccttagctctgcccagcgcctgtgcacccgctggcacccagtgcctc
atctccggctggggcaacaccctgagctctggagtcaactaccccaagctgctgcagtgc
ctggacaccccactgctgagtcaggccgagtgtgaagcctcgtaccctggacagatcact
gacaacatggtctgcgccggcttcctcgagggaggcaatgattcctgccagggtgactct
ggcggccctctggcctgcaacggagagctccagggcattgtttcctggggctctggctgt
gcccagaagggcaagcctggggtctacaccaaggtctgcaactatgtggactggattcag
cagaccatcgctgccaacagctaa

DBGET integrated database retrieval system