KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082805
Entry
103082805         CDS       T03090                                 

Gene name
MAP2K1
Definition
(RefSeq) mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04062  Chemokine signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04114  Oocyte meiosis
lve04140  Autophagy - animal
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04218  Cellular senescence
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04371  Apelin signaling pathway
lve04380  Osteoclast differentiation
lve04510  Focal adhesion
lve04540  Gap junction
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04620  Toll-like receptor signaling pathway
lve04650  Natural killer cell mediated cytotoxicity
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04666  Fc gamma R-mediated phagocytosis
lve04668  TNF signaling pathway
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04725  Cholinergic synapse
lve04726  Serotonergic synapse
lve04730  Long-term depression
lve04810  Regulation of actin cytoskeleton
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04914  Progesterone-mediated oocyte maturation
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve04928  Parathyroid hormone synthesis, secretion and action
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05034  Alcoholism
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05212  Pancreatic cancer
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103082805 (MAP2K1)
   04012 ErbB signaling pathway
    103082805 (MAP2K1)
   04014 Ras signaling pathway
    103082805 (MAP2K1)
   04015 Rap1 signaling pathway
    103082805 (MAP2K1)
   04370 VEGF signaling pathway
    103082805 (MAP2K1)
   04371 Apelin signaling pathway
    103082805 (MAP2K1)
   04668 TNF signaling pathway
    103082805 (MAP2K1)
   04066 HIF-1 signaling pathway
    103082805 (MAP2K1)
   04068 FoxO signaling pathway
    103082805 (MAP2K1)
   04072 Phospholipase D signaling pathway
    103082805 (MAP2K1)
   04071 Sphingolipid signaling pathway
    103082805 (MAP2K1)
   04024 cAMP signaling pathway
    103082805 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    103082805 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    103082805 (MAP2K1)
   04150 mTOR signaling pathway
    103082805 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103082805 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103082805 (MAP2K1)
   04210 Apoptosis
    103082805 (MAP2K1)
   04218 Cellular senescence
    103082805 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103082805 (MAP2K1)
   04540 Gap junction
    103082805 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103082805 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103082805 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103082805 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    103082805 (MAP2K1)
   04660 T cell receptor signaling pathway
    103082805 (MAP2K1)
   04662 B cell receptor signaling pathway
    103082805 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    103082805 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    103082805 (MAP2K1)
   04062 Chemokine signaling pathway
    103082805 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103082805 (MAP2K1)
   04929 GnRH secretion
    103082805 (MAP2K1)
   04912 GnRH signaling pathway
    103082805 (MAP2K1)
   04915 Estrogen signaling pathway
    103082805 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    103082805 (MAP2K1)
   04917 Prolactin signaling pathway
    103082805 (MAP2K1)
   04921 Oxytocin signaling pathway
    103082805 (MAP2K1)
   04926 Relaxin signaling pathway
    103082805 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    103082805 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    103082805 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    103082805 (MAP2K1)
   04916 Melanogenesis
    103082805 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103082805 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    103082805 (MAP2K1)
   04726 Serotonergic synapse
    103082805 (MAP2K1)
   04720 Long-term potentiation
    103082805 (MAP2K1)
   04730 Long-term depression
    103082805 (MAP2K1)
   04722 Neurotrophin signaling pathway
    103082805 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103082805 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103082805 (MAP2K1)
   05206 MicroRNAs in cancer
    103082805 (MAP2K1)
   05205 Proteoglycans in cancer
    103082805 (MAP2K1)
   05230 Central carbon metabolism in cancer
    103082805 (MAP2K1)
   05231 Choline metabolism in cancer
    103082805 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103082805 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103082805 (MAP2K1)
   05212 Pancreatic cancer
    103082805 (MAP2K1)
   05225 Hepatocellular carcinoma
    103082805 (MAP2K1)
   05226 Gastric cancer
    103082805 (MAP2K1)
   05214 Glioma
    103082805 (MAP2K1)
   05216 Thyroid cancer
    103082805 (MAP2K1)
   05221 Acute myeloid leukemia
    103082805 (MAP2K1)
   05220 Chronic myeloid leukemia
    103082805 (MAP2K1)
   05218 Melanoma
    103082805 (MAP2K1)
   05211 Renal cell carcinoma
    103082805 (MAP2K1)
   05219 Bladder cancer
    103082805 (MAP2K1)
   05215 Prostate cancer
    103082805 (MAP2K1)
   05213 Endometrial cancer
    103082805 (MAP2K1)
   05224 Breast cancer
    103082805 (MAP2K1)
   05223 Non-small cell lung cancer
    103082805 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103082805 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    103082805 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    103082805 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103082805 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103082805 (MAP2K1)
   05135 Yersinia infection
    103082805 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103082805 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    103082805 (MAP2K1)
   05161 Hepatitis B
    103082805 (MAP2K1)
   05160 Hepatitis C
    103082805 (MAP2K1)
   05164 Influenza A
    103082805 (MAP2K1)
   05163 Human cytomegalovirus infection
    103082805 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103082805 (MAP2K1)
   05165 Human papillomavirus infection
    103082805 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103082805 (MAP2K1)
   01522 Endocrine resistance
    103082805 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103082805 (MAP2K1)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103082805 (MAP2K1)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103082805 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 103082805
NCBI-ProteinID: XP_007448189
UniProt: A0A340WM60
LinkDB
Position
Un
AA seq 393 aa
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHVAGI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccggcccccgacggctccgcggtt
aacgggaccagctcggcagagaccaacctggaggccttgcaaaagaagctggaggagctg
gagctcgatgaacagcagcggaagcgccttgaggccttccttacccagaagcagaaggtg
ggagaactgaaggatgacgactttgagaagatcagtgagctgggtgctggcaatggaggt
gtggtgttcaaggtctcccacaagccgtctggtctggttatggccagaaagctaattcac
ctggagatcaaacctgcaatccggaaccagatcatacgggagctgcaggttctacatgag
tgcaactccccttacattgtgggcttctatggtgcattctacagtgatggcgagatcagt
atctgcatggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaaga
attcctgaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctg
agggagaagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactcc
cgtggggagatcaagctgtgtgactttggggtcagcgggcagctcatcgactccatggcc
aactccttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattac
tcggtgcagtcggacatctggagcatggggctctctctggttgagatggcggtcgggagg
tatcccatccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggag
ggagatgcggctgagacaccgccccggccaaggactcccggaaggcccctcagctcttat
ggaatggacagccgacctcccatggcaatttttgagttgttggattacatagtcaatgag
cctcctccaaagttgcccagtggagtattcagtctggaatttcaagattttgtgaataaa
tgcttaataaaaaaccctgcagagagagcagatttgaagcaactcatggttcatgctttt
atcaagagatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggc
cttaaccagcccagcacacccacccacgtggctggcatctaa

KEGG   Lipotes vexillifer (Yangtze River dolphin): 103090769
Entry
103090769         CDS       T03090                                 

Gene name
MAP2K2
Definition
(RefSeq) mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve01521  EGFR tyrosine kinase inhibitor resistance
lve01522  Endocrine resistance
lve04010  MAPK signaling pathway
lve04012  ErbB signaling pathway
lve04014  Ras signaling pathway
lve04015  Rap1 signaling pathway
lve04022  cGMP-PKG signaling pathway
lve04024  cAMP signaling pathway
lve04066  HIF-1 signaling pathway
lve04068  FoxO signaling pathway
lve04071  Sphingolipid signaling pathway
lve04072  Phospholipase D signaling pathway
lve04140  Autophagy - animal
lve04150  mTOR signaling pathway
lve04151  PI3K-Akt signaling pathway
lve04210  Apoptosis
lve04218  Cellular senescence
lve04270  Vascular smooth muscle contraction
lve04370  VEGF signaling pathway
lve04371  Apelin signaling pathway
lve04540  Gap junction
lve04550  Signaling pathways regulating pluripotency of stem cells
lve04620  Toll-like receptor signaling pathway
lve04650  Natural killer cell mediated cytotoxicity
lve04660  T cell receptor signaling pathway
lve04662  B cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04720  Long-term potentiation
lve04722  Neurotrophin signaling pathway
lve04730  Long-term depression
lve04810  Regulation of actin cytoskeleton
lve04910  Insulin signaling pathway
lve04912  GnRH signaling pathway
lve04915  Estrogen signaling pathway
lve04916  Melanogenesis
lve04917  Prolactin signaling pathway
lve04919  Thyroid hormone signaling pathway
lve04921  Oxytocin signaling pathway
lve04926  Relaxin signaling pathway
lve04929  GnRH secretion
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05010  Alzheimer disease
lve05022  Pathways of neurodegeneration - multiple diseases
lve05132  Salmonella infection
lve05135  Yersinia infection
lve05160  Hepatitis C
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05164  Influenza A
lve05165  Human papillomavirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05167  Kaposi sarcoma-associated herpesvirus infection
lve05170  Human immunodeficiency virus 1 infection
lve05200  Pathways in cancer
lve05205  Proteoglycans in cancer
lve05206  MicroRNAs in cancer
lve05210  Colorectal cancer
lve05211  Renal cell carcinoma
lve05213  Endometrial cancer
lve05214  Glioma
lve05215  Prostate cancer
lve05216  Thyroid cancer
lve05218  Melanoma
lve05219  Bladder cancer
lve05220  Chronic myeloid leukemia
lve05221  Acute myeloid leukemia
lve05223  Non-small cell lung cancer
lve05224  Breast cancer
lve05225  Hepatocellular carcinoma
lve05226  Gastric cancer
lve05230  Central carbon metabolism in cancer
lve05231  Choline metabolism in cancer
lve05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103090769 (MAP2K2)
   04012 ErbB signaling pathway
    103090769 (MAP2K2)
   04014 Ras signaling pathway
    103090769 (MAP2K2)
   04015 Rap1 signaling pathway
    103090769 (MAP2K2)
   04370 VEGF signaling pathway
    103090769 (MAP2K2)
   04371 Apelin signaling pathway
    103090769 (MAP2K2)
   04066 HIF-1 signaling pathway
    103090769 (MAP2K2)
   04068 FoxO signaling pathway
    103090769 (MAP2K2)
   04072 Phospholipase D signaling pathway
    103090769 (MAP2K2)
   04071 Sphingolipid signaling pathway
    103090769 (MAP2K2)
   04024 cAMP signaling pathway
    103090769 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    103090769 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    103090769 (MAP2K2)
   04150 mTOR signaling pathway
    103090769 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103090769 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    103090769 (MAP2K2)
   04218 Cellular senescence
    103090769 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103090769 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103090769 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103090769 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103090769 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    103090769 (MAP2K2)
   04660 T cell receptor signaling pathway
    103090769 (MAP2K2)
   04662 B cell receptor signaling pathway
    103090769 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    103090769 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103090769 (MAP2K2)
   04929 GnRH secretion
    103090769 (MAP2K2)
   04912 GnRH signaling pathway
    103090769 (MAP2K2)
   04915 Estrogen signaling pathway
    103090769 (MAP2K2)
   04917 Prolactin signaling pathway
    103090769 (MAP2K2)
   04921 Oxytocin signaling pathway
    103090769 (MAP2K2)
   04926 Relaxin signaling pathway
    103090769 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    103090769 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    103090769 (MAP2K2)
   04916 Melanogenesis
    103090769 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103090769 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    103090769 (MAP2K2)
   04730 Long-term depression
    103090769 (MAP2K2)
   04722 Neurotrophin signaling pathway
    103090769 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103090769 (MAP2K2)
   05206 MicroRNAs in cancer
    103090769 (MAP2K2)
   05205 Proteoglycans in cancer
    103090769 (MAP2K2)
   05230 Central carbon metabolism in cancer
    103090769 (MAP2K2)
   05231 Choline metabolism in cancer
    103090769 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103090769 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103090769 (MAP2K2)
   05225 Hepatocellular carcinoma
    103090769 (MAP2K2)
   05226 Gastric cancer
    103090769 (MAP2K2)
   05214 Glioma
    103090769 (MAP2K2)
   05216 Thyroid cancer
    103090769 (MAP2K2)
   05221 Acute myeloid leukemia
    103090769 (MAP2K2)
   05220 Chronic myeloid leukemia
    103090769 (MAP2K2)
   05218 Melanoma
    103090769 (MAP2K2)
   05211 Renal cell carcinoma
    103090769 (MAP2K2)
   05219 Bladder cancer
    103090769 (MAP2K2)
   05215 Prostate cancer
    103090769 (MAP2K2)
   05213 Endometrial cancer
    103090769 (MAP2K2)
   05224 Breast cancer
    103090769 (MAP2K2)
   05223 Non-small cell lung cancer
    103090769 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103090769 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    103090769 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103090769 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103090769 (MAP2K2)
   05135 Yersinia infection
    103090769 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103090769 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    103090769 (MAP2K2)
   05161 Hepatitis B
    103090769 (MAP2K2)
   05160 Hepatitis C
    103090769 (MAP2K2)
   05164 Influenza A
    103090769 (MAP2K2)
   05163 Human cytomegalovirus infection
    103090769 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103090769 (MAP2K2)
   05165 Human papillomavirus infection
    103090769 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103090769 (MAP2K2)
   01522 Endocrine resistance
    103090769 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103090769 (MAP2K2)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103090769 (MAP2K2)
Protein kinases [BR:lve01001]
 Serine/threonine kinases: STE group
  STE7 family
   103090769 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo CAMSAP_CC1
Other DBs
NCBI-GeneID: 103090769
NCBI-ProteinID: XP_007460577
UniProt: A0A340XKD9
LinkDB
Position
Un
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGIFTQDFQEFVNKCLIKNPAERADL
KMLMNHAFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctgcagaagaag
ctagaggagctagaacttgacgagcagcagaagaaacggctggaagccttcctcacccag
aaggccaaggtcggggagctcaaggacgatgactttgaaaggatctcggagctgggagcc
gggaacggtggggtggtcaccaaggtccagcacagaccctcgggcctcatcatggcaaga
aagctgatccacctggagatcaagccagccatccggaaccagatcatccgtgagctgcag
gtgctgcatgagtgtaactcgccgtacattgtgggcttctatggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggtggctccctggaccaggtgttgaaa
gaagccaagaggatccccgaagagatcctggggaaggtcagcatcgcggttctgcggggc
ctggcgtatctccgggagaagcaccagatcatgcaccgagatgtgaagccatccaacatc
ctcgtcaactcccgaggggagatcaagctgtgcgactttggggtgagcgggcagctcatc
gactccatggccaactccttcgtggggacgcggtcctacatgtctccggagcggctgcaa
ggcactcactactcggtgcagtcagacatctggagcatgggcctgtccctggtggagctg
tccattggaaggtaccccatccccccgccggatgccaaggagctggaggccatatttggc
cggcccatggtcgacggcgcggaaggagagcctcacagcatctcgccgcggccgagaccc
cccggacgccccatcagcggtcatgggatggacagccggccggccatggcaatctttgag
ctgctggactacatcgtgaacgagcctcctcccaagctgcccaacggcatcttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagcagagcgagcagatctg
aagatgctcatgaaccacgccttcatcaagcggtccgaggtggaagaagtggattttgcc
ggctggttgtgtaaaacgctgcggctgaaccagcccagcacgcccacacgcactgccgtc
tga

DBGET integrated database retrieval system