KEGG   Lipotes vexillifer (Yangtze River dolphin): 103082888Help
Entry
103082888         CDS       T03090                                 

Gene name
SEC63
Definition
(RefSeq) SEC63 homolog, protein translocation regulator
  KO
K09540  translocation protein SEC63
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve03060  Protein export
lve04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    103082888 (SEC63)
   04141 Protein processing in endoplasmic reticulum
    103082888 (SEC63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lve03110]
    103082888 (SEC63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lve02044]
    103082888 (SEC63)
Chaperones and folding catalysts [BR:lve03110]
 Heat shock proteins
  HSP40 / DNAJ
   103082888 (SEC63)
Secretion system [BR:lve02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   103082888 (SEC63)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ
Motif
Other DBs
NCBI-GeneID: 103082888
NCBI-ProteinID: XP_007447315
UniProt: A0A340WJZ1
LinkDB All DBs
Position
Un
AA seq 760 aa AA seqDB search
MAGQQFQYDDSGNTFFYFLTSFVGLIVIPATYYLWPRDQNAEQNRLKNIRKVYGRCMWYR
LRLLKPQPNIIPTVKKIVLLAGWALLLFLTYKVSKTDREYQEYNPYEVLNLDPGATVAEI
KKQYRLLSLKYHPDKGGDEVVFMRIAKAYAALTDEESRKNWEEFGNPDGPQATSFGIALP
AWIVDQKNSILVLLVYGLAFMVILPVVVGSWWYRSIRYSGDQILIRTTQIYTYFVYKTRN
MDMKRLIMVLAGASEFDPQYNKDATSRPTDNILIPQLIREIGSINLKKNEPPLTCPYSLK
ARVLLLSHLARMKIPETLEEDQQFMLKKCPALLQEMVNVICQLIIMARSREEREFRAPTL
ASLENCMKLSQMAVQGLQQFKSPLLQLPHIEEDNLRRVSNHKKYKIKTIQDLVSLKESDR
HNLLHFLEDEKYEEVMAVLGSFPYVTMDIKSQVLDDEDSNNITVGSLVTVLVKLTRQTMA
EVFEKEQSICAAEEQPAEDGQGDTSKNRTKGGWQQKSKGPKKTAKSKKKKPLKKKPTPVP
LSQPKQQKQKQANGVVGSEAAVKEDEEEVSDKGSDSEEEETNRDSQSEKDDGSDRDSDRE
QDEKQNRDDEAEWQELQQSIQRKERALLETKSKITHPIYSLYFPEEKQEWWWLYIADRKE
QTLISMPYHVCTLKDMEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAK
PVPENHPQWDTAVEGDEDQEDSEGFEDSFEEEEEEEEDDD
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcggggcagcagttccagtacgatgacagcgggaataccttcttctacttcctcacc
tccttcgtggggctcatcgtgatcccggccacatactacctctggccccgagatcagaat
gccgagcaaaatcgattaaagaatatcagaaaagtatatggaagatgtatgtggtatcgt
ttacggttattaaaacctcagccaaatattattcctacagtaaagaaaatagttctgctt
gcaggatgggcattgttattattccttacgtacaaagtttccaaaacagaccgagaatat
caagaatacaatccttatgaagtattaaatttggatcccggggcaacagtagcagaaatt
aagaaacagtatcgtttgctgtcacttaagtatcatccagataaaggaggtgatgaagtc
gtgttcatgaggatagcaaaagcttatgcagctttaactgatgaagagtcccggaaaaat
tgggaagagtttggaaatccagatgggcctcaagccacaagctttggaattgccctgcca
gcttggatagttgaccagaaaaattcaattttggttttacttgtatatggattggcgttc
atggttatccttccagttgttgtgggctcttggtggtatcgctcaatacgctatagtgga
gaccagattctaatacgcacaacacagatttatacatattttgtttataaaacccgaaat
atggatatgaaacgtcttatcatggtcttggctggagcctctgaatttgatcctcagtat
aacaaggatgccacaagcagaccaacagataatattctaatacctcagctaatcagagaa
attggcagcattaatttaaagaagaatgagccgccacttacctgcccatatagcctgaag
gccagagttcttttactgtctcatcttgctagaatgaaaattcctgagacccttgaagaa
gatcagcaatttatgctgaaaaaatgccctgccctacttcaagaaatggttaatgtaatc
tgccaactaataataatggcccggagccgtgaagaaagggagtttcgtgctccaactttg
gcatccctggaaaactgcatgaagctttcccagatggctgtgcaaggccttcagcagttt
aagtctccccttctgcagctccctcacattgaagaagacaatcttagaagggtttctaat
cataaaaagtacaaaattaagactatccaggatttggtgagtttaaaagaatcagatcgt
cacaatctattgcacttccttgaagatgaaaagtatgaagaggttatggctgtccttggg
agtttcccatatgtgaccatggacataaaatcacaggtattggatgatgaagatagcaac
aacatcacagtaggatccttagttacagtgttggttaaattgacaaggcaaacaatggca
gaagtatttgaaaaggagcagtccatctgtgctgcagaggaacagccagcagaagatggg
cagggtgatactagcaagaacagaacaaaaggaggatggcaacagaagagtaaaggaccc
aagaaaactgctaaatcaaaaaaaaagaaacctttaaaaaaaaaacctacacctgtgccc
ttatcacaaccaaagcaacagaaacaaaagcaggctaatggagtcgttgggagtgaggct
gcagtaaaggaagatgaagaagaagtttctgacaaaggcagcgactctgaggaagaagaa
accaatagagactctcaaagcgaaaaagatgatggtagtgacagagactctgatagagag
caagatgaaaaacaaaacagggatgatgaagcagagtggcaagaattacaacaaagtata
cagcgaaaggagcgagctctgctggaaaccaaatcaaagataacacatcctatttatagt
ctttactttcctgaggaaaaacaagaatggtggtggctttatatcgcagataggaaggaa
cagacattaatatctatgccatatcatgtgtgcacactaaaagatatggaagaggtagaa
ctgaagtttcctgcaccaggaaagcctggaaattatcaatatacagtgtttctaagatca
gactcctatatgggtttggatcagattaaaccattgaagttggaagttcatgaggctaag
cctgtgccagaaaatcacccacagtgggatacagcagtagagggggatgaagaccaggag
gacagcgagggctttgaagatagctttgaggaagaggaagaagaggaggaagatgatgac
taa

DBGET integrated database retrieval system