KEGG   Lipotes vexillifer (Yangtze River dolphin): 103083166
Entry
103083166         CDS       T03090                                 

Gene name
PTK2B
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04020  Calcium signaling pathway
lve04062  Chemokine signaling pathway
lve04072  Phospholipase D signaling pathway
lve04650  Natural killer cell mediated cytotoxicity
lve04670  Leukocyte transendothelial migration
lve04912  GnRH signaling pathway
lve05135  Yersinia infection
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103083166 (PTK2B)
   04072 Phospholipase D signaling pathway
    103083166 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103083166 (PTK2B)
   04670 Leukocyte transendothelial migration
    103083166 (PTK2B)
   04062 Chemokine signaling pathway
    103083166 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103083166 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103083166 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103083166 (PTK2B)
   05161 Hepatitis B
    103083166 (PTK2B)
   05163 Human cytomegalovirus infection
    103083166 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lve01001]
    103083166 (PTK2B)
Enzymes [BR:lve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103083166 (PTK2B)
Protein kinases [BR:lve01001]
 Non-receptor tyrosine kinases
  FAK family
   103083166 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 103083166
NCBI-ProteinID: XP_007466228
UniProt: A0A340XYL7
LinkDB
Position
Un
AA seq 1009 aa
MSGVSETLSRVKVGTLRRPEGPPEPMVAVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREVITSILLSGRIGPNIQLADCYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHMEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETFRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
QFKHIKSIRCLPLEEGQAVLQIGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIIRPKKDGEKRDSLPQIPTLNLEARRSHISESCSIESDIYTEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTSHKGEKINVAVKTCKKDCTLDSKEKFVSEAVIMRN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNCLKVLTLVLYSLQICKAMAYL
ESISCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSERPRFTELVCSLSDIYQTEKDVAIEQERNARYRPPKVLEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAERVRMRQLQEKQQKQMVEDYQWLRQEERSLDPMVYMNDKSP
LTPEKEVGYTEFTGPPEKPPRLGAQSIQPTANLDRTHDLVYLNVMELVRAVLDLKNELCQ
LPPEGYVVVVKNVGLTLRKLIASVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAQPLAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtccggggtttctgagaccctgagccgagtgaaggtgggcacgttacgtcggcctgaa
ggccccccagagcccatggtggcagtgccagtagacgtggaaaaggaagacgtgcggatc
ctcaaggtctgcttctatagcaacagcttcaaccccgggaagaacttcaaactagttaaa
tgcactgtgcagaccgagatccgggaggtcatcacctccatcctgctgagcgggcggatc
gggcccaacatccagctggcggactgctacgggctgaggctgaagcacatgaagtcggat
gagatccactggctgcacccgcagatgacggtgggcgaggtgcaggacaagtacgagtgt
ctacacatggaagcggagtggaggtatgaccttcaaatccgctacctaccagaggacttc
atggagagcctgaaagaagacaggaccacactgctttatttttaccaacagctccgcaat
gactacatgcaacgctatgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggacatgccccacaacgcactggacaaaaagtccaac
ttcgagctcctggagaaagaagtggggctggacctgtttttcccaaagcagatgcaggag
aacttgaagcccaagcaattccgaaagatgatccagcagacgttccagcagtatgcctcg
ctccgggaggaggagtgcgtcatgaagttcttcaacaccctcgcaggctttgccaacatc
gaccaggagacctttcgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaaggaatccgccagctgacaagtcaagatgcaaagcccacctgcctggcc
cagttcaagcacatcaagtccatcaggtgcctcccgctggaggagggccaggcggtactg
cagataggcattgaaggcgcccctcagtccttgtccatcaaaacctcctctctggcagag
gccgagaacatggctgacctcgtagacggttactgccggctgcagggggagcacaaaggc
tctctcatcattcgacccaagaaagatggtgagaagcgggacagcctgcctcagatcccc
acactaaacctggaggctcggcgatcccacatctcagaaagctgcagcatagaatcagac
atctatacagagattcccgacgagaccctgcgaagaccaggaggcccacagtacggcatt
gcccgggaagatgtagtcctgaatcgtattcttggtgaaggcttttttggggaggtctac
gaaggtgtctacacgagtcacaaaggggagaaaatcaacgtggctgtaaagacctgcaag
aaagactgcactctggacagcaaggagaagttcgtgagtgaggcagtgatcatgaggaac
ctggatcacccgcacatcgtgaagctgatcggcataattgaagaggagcccacctggatc
atcatggaactgtacccctacggggagctgggccactacctggagcgaaacaagaactgc
ctgaaggtgctcactcttgtcctgtactcgctgcagatctgcaaggccatggcctacctg
gagagcatcagctgtgtccacagggacatcgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggcctttcccggtacattgaggatgaggagtattac
aaagcttctgtgacgcgtctccctatcaaatggatgtcccccgagtccattaacttccgg
cgcttcacgacggccagtgacgtctggatgtttgccgtgtgcatgtgggaaatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctcgagaag
ggggaccggctgcccaagcctgacctctgcccacctgttctctacaccctcatgacccgc
tgctgggactacgaccccagtgagcggccccgcttcactgagctcgtgtgcagcctcagt
gacatttatcagacagagaaggacgtcgccatagagcaggagaggaacgctcgctaccga
cctcccaaagtcttggagcccacggccttccaggagcccccacccaagcccagccggccc
aagtacagaccccctccacaaaccaaccttctggcacccaagctgcaattccaggtccct
gagggtctgtgtgccagctcacccacgctcaccagccctatggagtatccatctcccgta
aactctctgcacaccccacctctccaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaggaggcccagcagctgtgggaggccgag
agggtcaggatgcggcagctccaggagaagcagcagaagcagatggtggaagactaccag
tggctgaggcaggaggagagatccctggaccccatggtttacatgaatgacaagtccccg
ttgaccccagagaaggaggtcggctacacggagttcacgggccccccagagaagccaccg
aggctgggcgcgcagtccatccagcccacagccaacctggaccggacccacgacctggtg
tacctcaacgtcatggagctggtgcgggctgtgctggacctcaagaatgagctctgccag
ctgccccccgagggctacgtggtggtggtgaagaacgtgggcctgacgctgcggaagctc
atcgcgagtgtggacgacctcctgccgtccttgccgtcgtcttcgcggacagagatcgag
gggacccagaaactgctcaacaaggacctggcggagctcatcaataagatgcgactggcg
cagcaaaacgccgtgacctccctgagtgaggagtgcaaacggcagatgctcaccgcctcc
cacacgctggctgtggatgccaagaacctgctggacgccgtggaccaggccaaggttctg
gccaacctggcccagccgctggcagagtga

DBGET integrated database retrieval system